9OUQ: Gamma-aminobutyric acid receptor subunit alpha-1

Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in complex with GABA. Determined by electron microscopy at 2.89 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.89 Å
Organisms: Rattus norvegicus, Mus musculus
Chains: 9
Atoms: 12,349
Mol. weight: 367.19 kDa
Ligands: NAG, ABU
Released: 18 Feb 2026

Explore 9OUQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OUQ contains 28 α-helices and 121 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	12-22	11
β-strand	38-53	16	1
β-strand	58-70	13	1
β-strand	82-85	4	1
α-helix	87-90	4
β-strand	98-100	3	2
β-strand	103	1	1
β-strand	107-108	2	1
β-strand	112	1	3
β-strand	116-121	6	1
β-strand	125-137	13	1
α-helix	142-144	3
β-strand	149-158	10	2
β-strand	166-170	5	1
α-helix	174-176	3
β-strand	178-180	3	1
β-strand	185	1	1
β-strand	190-204	15	2
β-strand	207-220	14	2

Chain B: 6 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	8-19	12
α-helix	35	1
β-strand	36-51	16	4
β-strand	56-68	13	4
α-helix	70-72	3
β-strand	81-83	3	4
α-helix	85-90	6
β-strand	96-98	3	5
β-strand	101-106	6	4
β-strand	110	1	2
β-strand	114-118	5	4
β-strand	123-134	12	4
α-helix	140-142	3
β-strand	147-156	10	5
β-strand	164-168	5	4
α-helix	171-174	4
β-strand	175-176	2	4
β-strand	186-200	15	5
β-strand	203-216	14	5

Chain C: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	12-21	10
β-strand	38-48	11	6
β-strand	49	1	7
β-strand	52-53	2	6
β-strand	58-70	13	6
α-helix	72-74	3
β-strand	82-85	4	6
α-helix	87-90	4
β-strand	98-100	3	8
β-strand	103	1	6
β-strand	107-108	2	6
β-strand	116-121	6	6
β-strand	125-137	13	6
β-strand	149-158	10	8
β-strand	166-170	5	6
α-helix	174-176	3
β-strand	178-180	3	6
β-strand	185	1	7
β-strand	190-203	14	8
β-strand	208-220	13	8

Chain D: 3 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	26-35	10
α-helix	43	1
α-helix	50	1
β-strand	51-66	16	9
β-strand	71-83	13	9
β-strand	95-98	4	9
β-strand	111-113	3	10
β-strand	116-121	6	9
β-strand	129-134	6	9
β-strand	138-149	12	9
β-strand	162-163	2	10
β-strand	168-171	4	10
β-strand	179-190	12	9
β-strand	201-215	15	10
β-strand	218-231	14	10

Chain E: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	9-19	11
α-helix	28	1
α-helix	35	1
β-strand	36-51	16	11
β-strand	56-68	13	11
β-strand	81-83	3	11
α-helix	85-89	5
β-strand	96-98	3	3
β-strand	101-106	6	11
β-strand	110	1	10
β-strand	114-118	5	11
β-strand	123-135	13	11
β-strand	147-156	10	3
β-strand	164-168	5	11
α-helix	171-174	4
β-strand	175-176	2	11
β-strand	186-200	15	3
β-strand	203-216	14	3

Chain H: 3 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	12
β-strand	10-12	3	13
β-strand	18-25	8	12
α-helix	29-31	3
β-strand	34-39	6	13
β-strand	45-51	7	13
β-strand	57-59	3	13
α-helix	61-63	3
β-strand	64	1	12
β-strand	67-72	6	12
β-strand	77-82	6	12
α-helix	84-86	3
β-strand	88-95	8	13
β-strand	100A-103	4	13
β-strand	104	1	12
β-strand	107-111	5	13

Chain J: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	14
β-strand	5-6	2	15
β-strand	10-12	3	16
β-strand	18-23	6	15
β-strand	34-39	6	16
β-strand	45-52	8	16
β-strand	56-59	4	16
α-helix	61-63	3
β-strand	64	1	15
β-strand	67-72	6	15
β-strand	77-82	6	15
α-helix	84-86	3
β-strand	88-94	7	16
β-strand	103	1	16
β-strand	104	1	14
β-strand	107-111	5	16

Chain K: 1 helix, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	17
β-strand	10-12	3	18
β-strand	15	1	19
β-strand	17	1	19
β-strand	19-25	7	17
β-strand	33-38	6	18
β-strand	45-49	5	18
β-strand	53-54	2	18
α-helix	55	1
β-strand	62-66	5	17
β-strand	70-75	6	17
β-strand	85-90	6	18
β-strand	96-97	2	18
β-strand	101-104	4	18

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Gamma-aminobutyric acid receptor subunit alpha-1	A, C	protein	455	Rattus norvegicus	P62813 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-2	B	protein	474	Rattus norvegicus	P63138 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit gamma-2	D	protein	466	Rattus norvegicus	P18508 (AlphaFold model)
Gamma-aminobutyric acid receptor subunit beta-1	E	protein	474	Rattus norvegicus	P15431 (AlphaFold model)
8E3 Fab heavy chain	H, J	protein	223	Mus musculus
8E3 Fab light chain	K, L	protein	213	Mus musculus

Sequence of entity 1 (A, C), FASTA

>9OUQ_1 Gamma-aminobutyric acid receptor subunit alpha-1 (chains A, C)
MKKSRGLSDYLWAWTLILSTLSGRSYGQPSQDELKDNTTVFTRILDRLLDGYDNRLRPGL
GERVTEVKTDIFVTSFGPVSDHDMEYTIDVFFRQSWKDERLKFKGPMTVLRLNNLMASKI
WTPDTFFHNGKKSVAHNMTMPNKLLRITEDGTLLYTMRLTVRAECPMHLEDFPMDAHACP
LKFGSYAYTRAEVVYEWTREPARSVVVAEDGSRLNQYDLLGQTVDSGIVQSSTGEYVVMT
THFHLKRKIGYFVIQTYLPCIMTVILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISAR
NSLPKVAYATAMDWFIAVCYAFVFSALIEFATVNYFTKRGYAWDGKSVVPEKPKKVKDPL
IKKNNTYAPTATSYTPNLARGDPGLATIAKSATIEPKEVKPETKPPEPKKTFNSVSKIDR
LSRIAFPLLFGIFNLVYWATYLNREPQLKAPTPHQ

Sequence of entity 2 (B), FASTA

>9OUQ_2 Gamma-aminobutyric acid receptor subunit beta-2 (chains B)
MWRVRKRGYFGIWSFPLIIAAVCAQSVNDPSNMSLVKETVDRLLKGYDIRLRPDFGGPPV
AVGMNIDIASIDMVSEVNMDYTLTMYFQQAWRDKRLSYNVIPLNLTLDNRVADQLWVPDT
YFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIES
YGYTTDDIEFYWRGDDNAVTGVTKIELPQFSIVDYKLITKKVVFSTGSYPRLSLSFKLKR
NIGYFILQTYMPSILITILSWVSFWINYDASAARVALGITTVLTMTTINTHLRETLPKIP
YVKAIDMYLMGCFVFVFMALLEYALVNYIFFGRGPQRQKKAAEKAANANNEKMRLDVNKM
DPHENILLSTLEIKNEMATSEAVMGLGDPRSTMLAYDASSIQYRKAGLPRHSFGRNALER
HVAQKKSRLRRRASQLKITIPDLTDVNAIDRWSRIFFPVVFSFFNIVYWLYYVN

Sequence of entity 3 (D), FASTA

>9OUQ_3 Gamma-aminobutyric acid receptor subunit gamma-2 (chains D)
MSSPNTWSTGSTVYSPVFSQKMTLWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKV
PEGDVTVILNNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTW
YDRRLKFNSTIKVLRLNSNMVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYT
LRLTIDAECQLQLHNFPMDEHSCPLEFSSYGYPREEIVYQWKRSSVEVGDTRSWRLYQFS
FVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTYIPCTLIVVLSWVSFWINKDAV
PARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSALVEYGTLHYFVS
NRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCCF
EDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL

Sequence of entity 4 (E), FASTA

>9OUQ_4 Gamma-aminobutyric acid receptor subunit beta-1 (chains E)
MWTVQNRESLGLLSFPVMVAMVCCAHSSNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPP
VDVGMRIDVASIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPD
TYFLNDKKSFVHGVTVKNRMIRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIE
SYGYTTDDIEFYWNGGEGAVTGVNKIELPQFSIVDYKMVSKKVEFTTGAYPRLSLSFRLK
RNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGITTVLTMTTISTHLRETLPKI
PYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANEKNKLEMNKVQ
VDAHGNILLSTLEIRNETSGSEVLTGVSDPKATMYSYDSASIQYRKPLSSREGFGRGLDR
HGVPGKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH

Sequence of entity 5 (H, J), FASTA

>9OUQ_5 8E3 Fab heavy chain (chains H, J)
EIQLQQSGPELVKPGTSVKVSCKASGYSFTDYNMYWVKQSHGKSLEWIGYIDPYNADTTY
NREFKGKATLTVDKSSSTAFMHLNSLTSEDSAVYYCARKRNNFYFDYWGQGTPLTVSSAK
TTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSGSLSSSVHTFPALLQSGLY
TMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKSAALEVLFQ

Sequence of entity 6 (K, L), FASTA

>9OUQ_6 8E3 Fab light chain (chains K, L)
YIVMTQSPKSMSMSLGERVTLSCRASEYVGSYVSWYQQKPEQSPKLLIYGASNRYTGVPD
RFAGSGSATDFTLTITSVQAEDLADYHCGQTYNYPTFGGGTKLEIKRADAAPTVSIFPPS
SEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTL
TKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1
ABU	Gamma-amino-butanoic acid	C4 H9 N O2	2

Primary citation

Molecular assemblies and pharmacology of cerebellar GABA A receptors. Sun, C., Jahncke, J.N., Wright, K.M. et al. Proc Natl Acad Sci U S A (2026) 123:e2524504123-e2524504123. DOI 10.1073/pnas.2524504123 · PubMed

Other PDB entries of the same protein (UniProt P62813 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9OUN 2.74 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUP 2.82 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUR 2.84 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta2-alpha1-gamma2 subtype, in…
9OUM 2.9 Å, Native GABA-A receptor from rat cerebella, beta2-alpha1-beta1-alpha6-gamma2 subtype, in…
9OUO 2.92 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta1-alpha1-gamma2 subtype, in…
9OV4 2.93 Å, Native GABA-A receptor from rat cerebella, beta1-alpha1-beta2-alpha1-gamma2 subtype, in…
6DW1 3.1 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…
6DW0 3.8 Å, Cryo-EM structure of the benzodiazepine-sensitive alpha1beta1gamma2S tri-heteromeric…

Browse structure collections

About this viewer

MolViewer shows 9OUQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.