9OWB: Human WRN helicase

Human WRN helicase in complex with allosteric ligand Compound 6. Determined by X-ray diffraction at 1.56 Å resolution. Released 10 Sept 2025.

Method: X-ray diffraction
Resolution: 1.56 Å
Organism: Spodoptera frugiperda
Chains: 4
Atoms: 16,027
Mol. weight: 206.52 kDa
Ligands: ZN, A1CEX
Released: 10 Sept 2025

Explore 9OWB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9OWB contains 92 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 23 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	531-533	3
α-helix	534-544	11
α-helix	551-563	13
β-strand	567-571	5	1
α-helix	579-588	10
β-strand	591-595	5	1
α-helix	599-611	13
β-strand	616-618	3	1
α-helix	624-632	9
β-strand	638-641	4	1
α-helix	643-647	5
α-helix	650-659	10
β-strand	662-667	6	1
α-helix	670-673	4
α-helix	682-689	8
α-helix	690-693	4
β-strand	699-703	5	1
α-helix	708-717	10
β-strand	724-728	5	1
β-strand	735-741	7	2
α-helix	746-750	5
α-helix	751-753	3
β-strand	755-757	3	3
β-strand	760-762	3	3
β-strand	767-770	4	2
α-helix	774-785	12
β-strand	791-794	4	2
α-helix	800-811	12
β-strand	817-820	4	2
β-strand	835-839	5	2
α-helix	845-852	8
β-strand	862-868	7	2
α-helix	873-875	3
α-helix	878-881	4
α-helix	886-904	19
α-helix	909-917	9
α-helix	920-925	6
β-strand	936	1	2
α-helix	937-940	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN	A, B, C, D	protein	443	Spodoptera frugiperda	Q14191 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9OWB_1 Bifunctional 3'-5' exonuclease/ATP-dependent helicase WRN (chains A, B, C, D)
NLGLPTKEEEEDDENEANEGEEDDDKDFLWPAPNEEQVTCLKMYFGHSSFKPVQWKVIHS
VLEERRDNVAVMATGYGKSLCFQYPPVYVGKIGLVISPLISLMEDQVLQLKMSNIPACFL
GSAQSENVLTDIKLGKYRIVYVTPEYCSGNMGLLQQLEADIGITLIAVDEAHCISEWGHD
FRDSFRKLGSLKTALPMVPIVALTATASSSIREDIVRCLNLRNPQITCTGFDRPNLYLEV
RRKTGNILQDLQPFLVKTSSHWEFEGPTIIYCPSRKMTQQVTGELRKLNLSCGTYHAGMS
FSTRKDIHHRFVRDEIQCVIATIAFGMGINKADIRQVIHYGAPKDMESYYQEIGRAGRDG
LQSSCHVLWAPADINLNRHLLTEIRNEKFRLYKLKMMAKMEKYLHSSRCRRQIILSHFED
KQVQKASLGIMGTEKCCDNCRSR

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4
A1CEX	N-[2-chloro-4-(trifluoromethyl)phenyl]-2-[(10'R)-1-(3-hydroxypyridine-2-carbony…	C31 H30 Cl F3 N8 O6	4

Water and common crystallization additives (EDO, CL) are not listed.

Primary citation

High-throughput evaluation of novel WRN inhibitors. Xu, H., Palte, R.L., Rickard, M.M. et al. SLAS Discov (2025) 35:100266-100266. DOI 10.1016/j.slasd.2025.100266 · PubMed

Other PDB entries of the same protein (UniProt Q14191 (AlphaFold model), which also has an AlphaFold model), best resolution first:

10AK 1.37 Å, Crystal Structure of Human WRN helicase with compound 4
7GQU 1.54 Å, Crystal Structure of Werner helicase fragment 517-945 in covalent complex with…
7GQS 1.57 Å, Crystal Structure of Werner helicase fragment 517-945 in complex with ADP
9MJU 1.58 Å, Crystal structure of WRN helicase with allosteric fragment 1
7XUT 1.6 Å, Crystal structure of RPA70N-WRN fusion
8PFP 1.6 Å, Crystal structure of WRN helicase domain in complex with ATPgammaS
9MJY 1.63 Å, Crystal structure of WRN helicase with bound allosteric compound 1
9OG8 1.66 Å, Crystal structure of WRN in complex with compound 43
9OWC 1.67 Å, Human WRN helicase in complex with allosteric ligand Compound 7
9MJZ 1.7 Å, Crystal structure of WRN helicase with bound allosteric compound 3
9MJT 1.73 Å, Crystal structure of apo WRN helicase in Form D
9MJX 1.73 Å, Crystal structure of WRN helicase with bound allosteric fragment 4

Browse structure collections

About this viewer

MolViewer shows 9OWB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.