9P95: Integrin alpha4beta7

CryoEM structure of integrin alpha4beta7 bound to MAdCAM-1. Determined by electron microscopy at 3.05 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 3.05 Å
Organism: Homo sapiens
Chains: 3
Atoms: 9,147
Mol. weight: 240.83 kDa
Ligands: MN, CA, NAG
Released: 24 Sept 2025

Explore 9P95 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P95 contains 26 α-helices and 115 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 63 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-12	4	2
β-strand	22-28	7	3
β-strand	31-38	8	3
β-strand	54-59	6	3
β-strand	69-71	3	3
β-strand	87-88	2	4
β-strand	94-100	7	5
β-strand	108-112	5	5
β-strand	116-117	2	4
β-strand	127-128	2	4
β-strand	130	1	6
β-strand	132-135	4	5
α-helix	141-143	3
β-strand	145-147	3	5
β-strand	167	1	6
β-strand	171-173	3	7
β-strand	177-182	6	7
β-strand	190	1	8
β-strand	191-196	6	7
β-strand	201-204	4	7
β-strand	205	1	9
β-strand	218	1	8
β-strand	221-225	5	9
β-strand	234-239	6	9
α-helix	242-244	3
β-strand	246	1	10
β-strand	247-253	7	9
β-strand	258-265	8	9
β-strand	273	1	10
β-strand	277-278	2	11
β-strand	290-294	5	11
β-strand	304	1	12
β-strand	305-311	7	11
β-strand	318-320	3	11
α-helix	324	1
β-strand	325	1	11
β-strand	335	1	12
β-strand	339-343	5	13
β-strand	352-356	5	13
α-helix	360-363	4
β-strand	365	1	14
β-strand	366-371	6	13
β-strand	372-373	2	15
β-strand	376-377	2	15
β-strand	383-386	4	13
β-strand	397	1	14
β-strand	401-405	5	2
α-helix	413	1
β-strand	414-419	6	2
β-strand	424-428	5	2
α-helix	429	1
β-strand	430	1	1
α-helix	431-432	2
β-strand	433-434	2	16
β-strand	439-440	2	17
β-strand	445	1	18
β-strand	453-455	3	19
β-strand	458-460	3	19
β-strand	462-469	8	17
β-strand	479-484	6	20
β-strand	487	1	21
β-strand	500-502	3	17
β-strand	513-518	6	20
β-strand	523-531	9	17
β-strand	542-546	5	21
β-strand	548-550	3	20
β-strand	569-570	2	16
β-strand	579-583	5	21
β-strand	584	1	18

Chain B: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	83-89	7	22
β-strand	94	1	23
β-strand	101	1	23
β-strand	104	1	24
β-strand	106-113	8	22
β-strand	114	1	25
β-strand	115	1	24
β-strand	117	1	25
β-strand	119-126	8	24
α-helix	130-132	3
β-strand	133-140	8	26
α-helix	143-148	6
α-helix	149-164	16
β-strand	170-177	8	26
α-helix	190-194	5
β-strand	211-217	7	26
α-helix	220-228	9
β-strand	240	1	27
α-helix	242-251	10
α-helix	253-256	4
β-strand	262-268	7	26
β-strand	273	1	27
α-helix	279-282	4
β-strand	286	1	28
α-helix	287-289	3
β-strand	299	1	26
α-helix	301-305	5
β-strand	306	1	28
α-helix	307-310	4
α-helix	311-321	11
β-strand	323-329	7	26
α-helix	334-343	10
β-strand	348-351	4	26
α-helix	357-367	11
β-strand	372-374	3	29
β-strand	376-378	3	22
α-helix	379-382	4
β-strand	385-393	9	24
β-strand	397-399	3	24
α-helix	404-407	4
β-strand	409-412	4	29
β-strand	417-426	10	24
β-strand	433-440	8	22
β-strand	446-453	8	22

Chain C: 3 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	30
β-strand	12-16	5	31
β-strand	21-27	7	30
β-strand	35-39	5	32
β-strand	48-51	4	30
β-strand	54-59	6	30
α-helix	64-66	3
β-strand	68-69	2	31
β-strand	71-76	6	32
β-strand	79-83	5	32
β-strand	86-90	5	31
β-strand	91	1	33
β-strand	96-99	4	34
β-strand	103	1	35
β-strand	109-114	6	34
β-strand	118	1	33
β-strand	125-131	7	36
β-strand	134-135	2	36
β-strand	140-145	6	34
α-helix	146	1
β-strand	148	1	37
β-strand	161	1	37
β-strand	164-168	5	34
α-helix	176-177	2
β-strand	179-188	10	36
β-strand	191-200	10	36
β-strand	201	1	35

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-4	A	protein	1023	Homo sapiens	P13612 (AlphaFold model)
Integrin beta-7	B	protein	776	Homo sapiens	P26010 (AlphaFold model)
Mucosal addressin cell adhesion molecule 1	C	protein	370	Homo sapiens	Q13477 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9P95_1 Integrin alpha-4 (chains A)
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVN
RTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIMKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEVTDNSGVVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVA
HVLLEGLHHQGTGGLEVLFQGPGENAQCEKELQALEKENAQLEWELQALEKELAQWSHPQ
FEK

Sequence of entity 2 (B), FASTA

>9P95_2 Integrin beta-7 (chains B)
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHDTSGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKLAQGGHHHHHH

Sequence of entity 3 (C), FASTA

>9P95_3 Mucosal addressin cell adhesion molecule 1 (chains C)
MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQW
RGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTV
SPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDED
VLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPES
PDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGP
TQGEVIPTGSSKPAGDQDTSGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKL
AQGGHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
MN	Manganese (II) ion	Mn	3
CA	Calcium ion	Ca	3
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Molecular exaptation by the integrin alpha I domain. Hollis, J.A., Chan, M.C., Malik, H.S. et al. Sci Adv (2025) 11:eadx9567-eadx9567. DOI 10.1126/sciadv.adx9567 · PubMed

Other PDB entries of the same protein (UniProt P13612 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HKC 2.2 Å, 14-3-3-zeta in complex with S1011 phosphorylated integrin alpha-4 peptide
5C7Z 2.77 Å, AP2 Mu2 adaptin C-terminal domain complexed with integrin alpha-4 peptide
5FPI 2.77 Å, Mu2 adaptin subunit of the AP2 adaptor (C-terminal domain) complexed with Integrin…
3V4V 3.1 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
9P96 3.1 Å, CryoEM structure of the apo integrin alpha4beta7
3V4P 3.15 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1

Browse structure collections

About this viewer

MolViewer shows 9P95 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.