9P96: Apo integrin alpha4beta7

CryoEM structure of the apo integrin alpha4beta7. Determined by electron microscopy at 3.1 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 3.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,446
Mol. weight: 155.08 kDa
Ligands: CA
Released: 24 Sept 2025

Explore 9P96 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P96 contains 23 α-helices and 84 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 61 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	1
β-strand	9-12	4	2
β-strand	22-28	7	3
β-strand	31-38	8	3
β-strand	54-59	6	3
β-strand	69-71	3	3
β-strand	87-88	2	4
β-strand	97-100	4	5
β-strand	108-111	4	5
β-strand	116-117	2	4
β-strand	127-128	2	4
β-strand	130	1	6
β-strand	132-135	4	5
α-helix	141-143	3
β-strand	145-147	3	5
β-strand	167	1	6
β-strand	171-173	3	7
β-strand	178-182	5	7
α-helix	185-188	4
β-strand	190	1	8
β-strand	191-196	6	7
β-strand	201-204	4	7
β-strand	218	1	8
β-strand	221-222	2	9
β-strand	225	1	9
β-strand	234-239	6	9
α-helix	242-244	3
β-strand	247-253	7	9
β-strand	258-260	3	9
β-strand	264-265	2	9
β-strand	277-280	4	10
β-strand	289-294	6	10
β-strand	304	1	11
β-strand	305-311	7	10
β-strand	318-325	8	10
β-strand	335	1	11
β-strand	339-341	3	12
β-strand	352-356	5	12
α-helix	360-363	4
β-strand	366-371	6	12
β-strand	372-373	2	13
β-strand	376-377	2	13
β-strand	383-386	4	12
α-helix	387-389	3
β-strand	397-405	9	2
β-strand	414-419	6	2
β-strand	424-428	5	2
β-strand	430	1	1
β-strand	433-434	2	14
β-strand	435-436	2	15
β-strand	440-441	2	16
β-strand	445	1	17
β-strand	453-455	3	18
β-strand	458-460	3	18
β-strand	462-467	6	16
β-strand	471-472	2	15
β-strand	479-484	6	19
β-strand	486	1	20
α-helix	497-498	2
β-strand	500-501	2	16
β-strand	513-518	6	19
β-strand	525-531	7	16
β-strand	542-547	6	20
β-strand	549	1	19
α-helix	564-567	4
β-strand	569-570	2	14
β-strand	578-583	6	20
β-strand	584	1	17

Chain B: 16 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	83-88	6	21
β-strand	104-105	2	22
β-strand	108-113	6	21
β-strand	119-126	8	22
β-strand	133-140	8	23
α-helix	143-145	3
α-helix	146-152	7
α-helix	155-164	10
β-strand	170-177	8	23
α-helix	190-193	4
β-strand	204	1	24
β-strand	211-217	7	23
α-helix	220-227	8
β-strand	232	1	24
β-strand	240	1	25
α-helix	243-251	9
α-helix	253-256	4
β-strand	262-269	8	23
β-strand	273	1	25
α-helix	279-282	4
α-helix	287-288	2
β-strand	299	1	23
α-helix	301-303	3
α-helix	308-310	3
α-helix	311-320	10
β-strand	324-329	6	23
α-helix	334-341	8
β-strand	348-351	4	23
α-helix	359-372	14
β-strand	375	1	26
β-strand	376-378	3	21
α-helix	380-382	3
β-strand	385-388	4	22
β-strand	391-392	2	22
β-strand	408	1	26
α-helix	412-413	2
β-strand	417-426	10	22
β-strand	434-440	7	21
β-strand	446-453	8	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-4	A	protein	1023	Homo sapiens	P13612 (AlphaFold model)
Integrin beta-7	B	protein	373	Homo sapiens	P26010 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9P96_1 Integrin alpha-4 (chains A)
MAWEARREPGPRRAAVRETVMLLLCLGVPTGRPYNVDTESALLYQGPHNTLFGYSVVLHS
HGANRWLLVGAPTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPNGEPCGKTCLE
ERDNQWLGVTLSRQPGENGSIVTCGHRWKNIFYIKNENKLPTGGCYGVPPDLRTELSKRI
APCYQDYVKKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFVYNITTNKYKAFLD
KQNQVKFGSYLGYSVGAGHFRSQHTTEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGK
KLGSYFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYINSGSGAVMNAMETNLVG
SDKYAARFGESIVNLGDIDNDGFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEG
LQISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVLLRTRPVVIVDASLSHPESVN
RTKFDCVENGWPSVCIDLTLCFSYKGKEVPGYIVLFYNMSLDVNRKAESPPRFYFSSNGT
SDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAAYHLGPHVISKRSTEEFPPLQ
PILQQKKEKDIMKKTINFARFCAHENCSADLQVSAKIGFLKPHENKTYLAVGSMKTLMLN
VSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCEVTDNSGVVQLDCSIGYIYVDH
LSRIDISFLLDVSSLSRAEEDLSITVHATCENEEEMDNLKHSRVTVAIPLKYEVKLTVHG
FVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNSMAPNVSVEIMVPNSFSPQTDKLF
NILDVQTTTGECHFENYQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADPHCLNF
LCNFGKMESGKEASVHIQLEGRPSILEMDETSALKFEIRATGFPEPNPRVIELNKDENVA
HVLLEGLHHQGTGGLEVLFQGPGENAQCEKELQALEKENAQLEWELQALEKELAQWSHPQ
FEK

Sequence of entity 2 (B), FASTA

>9P96_2 Integrin beta-7 (chains B)
GQQEVLQDQPLSQGARGEGATQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDL
SYSMKDDLERVRQLGHALLVRLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRL
ERCQSPFSFHHVLSLTGDAQAFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNV
SRLLVFTSDDTFHTAGDGKLGGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAA
NIQPIFAVTSAALPVYQELSKLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSL
PPGVHISYESQCEGPEKREGKAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRAL
GFSEELIVELHTL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6

Primary citation

Molecular exaptation by the integrin alpha I domain. Hollis, J.A., Chan, M.C., Malik, H.S. et al. Sci Adv (2025) 11:eadx9567-eadx9567. DOI 10.1126/sciadv.adx9567 · PubMed

Other PDB entries of the same protein (UniProt P13612 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HKC 2.2 Å, 14-3-3-zeta in complex with S1011 phosphorylated integrin alpha-4 peptide
5C7Z 2.77 Å, AP2 Mu2 adaptin C-terminal domain complexed with integrin alpha-4 peptide
5FPI 2.77 Å, Mu2 adaptin subunit of the AP2 adaptor (C-terminal domain) complexed with Integrin…
9P95 3.05 Å, CryoEM structure of integrin alpha4beta7 bound to MAdCAM-1
3V4V 3.1 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1 and RO0505376
3V4P 3.15 Å, crystal structure of a4b7 headpiece complexed with Fab ACT-1

Browse structure collections

About this viewer

MolViewer shows 9P96 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.