9P97: Closed integrin alphaEbeta7

CryoEM structure of the closed integrin alphaEbeta7 bound to fab LF61. Determined by electron microscopy at 2.92 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 2.92 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 12,243
Mol. weight: 264.81 kDa
Ligands: CA, NAG
Released: 24 Sept 2025

Explore 9P97 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P97 contains 61 α-helices and 134 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 31 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
α-helix	11-12	2
β-strand	19	1	2
β-strand	22-26	5	3
β-strand	33-38	6	3
β-strand	49-54	6	3
β-strand	59-63	5	3
α-helix	64	1
β-strand	77-82	6	4
β-strand	85-94	10	4
β-strand	103-111	9	4
β-strand	117-122	6	4
α-helix	126-128	3
β-strand	130	1	5
β-strand	183-190	8	6
α-helix	197-217	21
β-strand	221-228	8	6
β-strand	233-236	4	6
α-helix	240-242	3
α-helix	244-252	9
α-helix	263-269	7
α-helix	270-274	5
α-helix	277-279	3
β-strand	286-293	8	6
α-helix	304-308	5
α-helix	311-313	3
β-strand	316-323	8	6
α-helix	325-328	4
α-helix	330-339	10
α-helix	341	1
α-helix	344-347	4
β-strand	348-351	4	6
α-helix	356-360	5
α-helix	361-368	8
α-helix	370-371	2
α-helix	380-383	4
β-strand	386-392	7	5
β-strand	397-402	6	5
β-strand	410	1	7
β-strand	412-416	5	5
β-strand	421-425	5	5
α-helix	432-437	6
β-strand	443	1	7
β-strand	447-451	5	8
β-strand	456-461	6	8
α-helix	465-467	3
β-strand	469	1	9
β-strand	470-477	8	8
β-strand	480-488	9	8
β-strand	496	1	9
β-strand	499-503	5	10
β-strand	513-518	6	10
β-strand	522	1	11
β-strand	526	1	11
β-strand	528	1	12
β-strand	529-535	7	10
α-helix	536	1
β-strand	542-548	7	10
β-strand	559	1	12
β-strand	563-565	3	13
β-strand	576-581	6	13
β-strand	596-601	6	13
β-strand	602-603	2	14
β-strand	606-607	2	14
β-strand	613-616	4	13
α-helix	617-619	3
β-strand	631-633	3	1
β-strand	645-648	4	1
β-strand	651	1	2
β-strand	653-658	6	1
β-strand	661-662	2	15
β-strand	664-671	8	16
α-helix	675-676	2
β-strand	683-691	9	16
α-helix	698-700	3
α-helix	705	1
β-strand	706-713	8	17
β-strand	722-724	3	16
α-helix	727-730	4
β-strand	733-735	3	17
β-strand	742-751	10	16
α-helix	752	1
α-helix	755-757	3
α-helix	764-765	2
β-strand	766-774	9	17
α-helix	775-776	2
β-strand	786-787	2	15
β-strand	794-798	5	17

Chain B: 16 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	83-88	6	18
α-helix	90-92	3
β-strand	93	1	19
β-strand	102	1	19
β-strand	104-105	2	20
β-strand	108-113	6	18
β-strand	119-126	8	20
β-strand	133-140	8	21
α-helix	143-145	3
α-helix	146-152	7
α-helix	156-163	8
β-strand	170-177	8	21
α-helix	190-194	5
β-strand	211-217	7	21
α-helix	220-228	9
β-strand	240	1	22
α-helix	242-251	10
α-helix	253-256	4
β-strand	262-269	8	21
β-strand	273	1	22
α-helix	278-282	5
β-strand	286	1	23
α-helix	287-288	2
β-strand	294	1	24
β-strand	299	1	21
β-strand	300	1	24
α-helix	301-305	5
β-strand	306	1	23
α-helix	307-310	4
α-helix	311-321	11
β-strand	323-329	7	21
α-helix	334-343	10
β-strand	348-351	4	21
α-helix	359-371	13
β-strand	373-378	6	18
α-helix	380-382	3
β-strand	385-388	4	20
β-strand	389	1	25
β-strand	391-392	2	20
β-strand	404	1	25
β-strand	407-410	4	18
β-strand	417-426	10	20
β-strand	434-440	7	18
β-strand	447-453	7	18

Chain H: 7 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	26
β-strand	10-12	3	27
β-strand	18-25	8	26
β-strand	34-39	6	27
β-strand	46-53	8	27
β-strand	58-61	4	27
α-helix	63-65	3
β-strand	69-74	6	26
β-strand	79-84	6	26
α-helix	89-91	3
β-strand	93-99	7	27
β-strand	110-111	2	27
β-strand	112	1	26
β-strand	115-119	5	27
β-strand	125	1	28
β-strand	128-131	4	29
α-helix	133-135	3
α-helix	136-140	5
β-strand	143-153	11	29
β-strand	154	1	28
β-strand	159-162	4	30
α-helix	163-165	3
β-strand	172-173	2	29
α-helix	174-176	3
β-strand	177-179	3	29
β-strand	182-192	11	29
β-strand	202-207	6	30
α-helix	208-210	3
β-strand	212-217	6	30

Chain L: 7 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	31
β-strand	11-14	4	32
β-strand	20-21	2	33
β-strand	24-26	3	31
β-strand	31	1	34
β-strand	38	1	34
β-strand	40-45	6	32
β-strand	52-55	4	32
β-strand	61	1	32
α-helix	62	1
β-strand	69-70	2	33
β-strand	78-79	2	31
β-strand	82-83	2	33
α-helix	88-90	3
β-strand	93-98	6	32
α-helix	105	1
β-strand	106	1	27
β-strand	107	1	32
β-strand	111-115	5	32
β-strand	120	1	35
β-strand	123-127	5	36
α-helix	128-130	3
α-helix	131-135	5
β-strand	138-148	11	36
β-strand	149	1	35
β-strand	154-159	6	37
β-strand	162-164	3	37
β-strand	170-171	2	36
α-helix	172-173	2
β-strand	175	1	36
β-strand	181-190	10	36
α-helix	191-195	5
β-strand	200-205	6	37
β-strand	211-215	5	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-E	A	protein	1176	Homo sapiens	P38570 (AlphaFold model)
Integrin beta-7	B	protein	776	Homo sapiens	P26010 (AlphaFold model)
Fab LF61 Heavy Chain	H	protein	220	Mus musculus
Fab LF61 Light Chain	L	protein	215	Mus musculus

Sequence of entity 1 (A), FASTA

>9P97_1 Integrin alpha-E (chains A)
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHGTGGLEVLFQGPGENAQ
CEKELQALEKENAQLEWELQALEKELAQWSHPQFEK

Sequence of entity 2 (B), FASTA

>9P97_2 Integrin beta-7 (chains B)
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHDTSGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKLAQGGHHHHHH

Sequence of entity 3 (H), FASTA

>9P97_3 Fab LF61 Heavy Chain (chains H)
MVQLQRAGPTIVKPGSAVKLSCKATGFAYEDYYIFWVRQREGGNGQKWIGRIHPGSGETK
YNDKFKGKATLTADTEASSAYMRLTSLTSEDTAVWYCGWERSVGRATFAYWGQGTSVTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Sequence of entity 4 (L), FASTA

>9P97_4 Fab LF61 Light Chain (chains L)
AAITFNLAPESLVVTAGSKVTFSCKASQDFLNSATKRNYLTWYQQRDGKPPKLLIYWASA
RLSGVPARFTGSGGGGTEFTLTISSVKAADIGTYYCRQLRSRPLTFGGGTKLTVKQPKSS
PSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKY
MASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	6
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3

Primary citation

Molecular exaptation by the integrin alpha I domain. Hollis, J.A., Chan, M.C., Malik, H.S. et al. Sci Adv (2025) 11:eadx9567-eadx9567. DOI 10.1126/sciadv.adx9567 · PubMed

Other PDB entries of the same protein (UniProt P38570 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZJF 2.7 Å, Cryo-EM structure of human integrin alpha-E beta-7
9P98 2.93 Å, CryoEM structure of the open integrin alphaEbeta7 bound to fab LF61
9P99 3.37 Å, CryoEM structure of integrin alphaEbeta7 bound to E-cadherin

Browse structure collections

About this viewer

MolViewer shows 9P97 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.