9P98: Open integrin alphaEbeta7

CryoEM structure of the open integrin alphaEbeta7 bound to fab LF61. Determined by electron microscopy at 2.93 Å resolution. Released 24 Sept 2025.

Method: Electron microscopy
Resolution: 2.93 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 12,296
Mol. weight: 264.06 kDa
Ligands: NAG, CA
Released: 24 Sept 2025

Explore 9P98 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9P98 contains 50 α-helices and 146 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 66 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	1
α-helix	11-12	2
β-strand	19	1	2
β-strand	21-26	6	3
β-strand	33-38	6	3
β-strand	49-55	7	3
β-strand	58-63	6	3
β-strand	77-82	6	4
β-strand	85-94	10	4
β-strand	99	1	5
β-strand	103-111	9	4
β-strand	117-122	6	4
α-helix	126-128	3
β-strand	130	1	6
α-helix	134-137	4
β-strand	183-189	7	7
α-helix	197-217	21
β-strand	221-227	7	7
β-strand	229	1	8
β-strand	233-236	4	7
α-helix	239-242	4
α-helix	244-253	10
β-strand	261	1	8
α-helix	263-273	11
β-strand	286-292	7	7
β-strand	297	1	8
α-helix	304-308	5
β-strand	319-320	2	7
α-helix	330-339	10
β-strand	348	1	7
α-helix	358-363	6
β-strand	367	1	5
β-strand	369	1	9
β-strand	377	1	9
β-strand	390-392	3	6
β-strand	397-401	5	6
β-strand	410	1	10
β-strand	412-416	5	6
β-strand	421-425	5	6
α-helix	432-437	6
β-strand	443	1	10
β-strand	447-451	5	11
β-strand	456-462	7	11
β-strand	469	1	12
β-strand	470-474	5	11
β-strand	483-488	6	11
β-strand	496	1	12
β-strand	499-503	5	13
β-strand	513-517	5	13
β-strand	528	1	14
β-strand	530-535	6	13
α-helix	536	1
β-strand	542-548	7	13
β-strand	559	1	14
β-strand	562-565	4	15
β-strand	577-581	5	15
β-strand	595	1	16
β-strand	596-600	5	15
β-strand	602	1	17
β-strand	607	1	17
β-strand	613-616	4	15
α-helix	617-620	4
β-strand	627	1	16
β-strand	631-633	3	1
β-strand	645-648	4	1
β-strand	651	1	2
β-strand	653-658	6	1
α-helix	659-660	2
β-strand	661-662	2	18
β-strand	664-671	8	19
β-strand	675	1	20
α-helix	682	1
β-strand	683-691	9	19
α-helix	698-700	3
β-strand	706-713	8	21
β-strand	722-724	3	19
β-strand	733-735	3	21
β-strand	742-751	10	19
α-helix	752	1
α-helix	758-760	3
α-helix	764	1
β-strand	765-774	10	21
α-helix	783-785	3
β-strand	786-787	2	18
β-strand	794-799	6	21
β-strand	801	1	20

Chain B: 17 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	83-86	4	22
α-helix	98-100	3
β-strand	103-104	2	23
β-strand	108-113	6	22
β-strand	114	1	24
β-strand	117	1	24
β-strand	119-126	8	23
β-strand	133-140	8	25
α-helix	143-145	3
α-helix	149-164	16
β-strand	170-177	8	25
α-helix	190-194	5
β-strand	211-217	7	25
α-helix	220-229	10
β-strand	240	1	26
α-helix	242-251	10
α-helix	253-256	4
β-strand	263-269	7	25
β-strand	273	1	26
α-helix	279-282	4
α-helix	287-288	2
β-strand	299	1	25
α-helix	301-305	5
α-helix	307-310	4
α-helix	311-321	11
β-strand	323-329	7	25
α-helix	331-333	3
α-helix	334-341	8
β-strand	348-351	4	25
α-helix	357-369	13
β-strand	375	1	27
β-strand	377	1	28
α-helix	381-382	2
β-strand	385-392	8	23
α-helix	403-406	4
β-strand	408	1	27
β-strand	413	1	29
β-strand	416	1	29
β-strand	418-426	9	23
β-strand	434-436	3	22
β-strand	439	1	28
β-strand	446	1	28
β-strand	448-453	6	22

Chain H: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-6	4	30
β-strand	10-12	3	31
β-strand	18-25	8	30
β-strand	34-39	6	31
β-strand	46-53	8	31
β-strand	58-61	4	31
α-helix	63-65	3
β-strand	71-74	4	30
β-strand	79-84	6	30
α-helix	89-91	3
β-strand	93-97	5	31
β-strand	98-99	2	32
β-strand	110-111	2	32
β-strand	112	1	30
β-strand	115-119	5	31
β-strand	125	1	33
β-strand	128-131	4	34
α-helix	133-135	3
α-helix	136-140	5
β-strand	143-153	11	34
β-strand	154	1	33
β-strand	159-162	4	35
β-strand	172-173	2	34
α-helix	174-176	3
β-strand	177-179	3	34
β-strand	182-192	11	34
α-helix	193-195	3
β-strand	202-207	6	35
β-strand	212-217	6	35

Chain L: 7 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	36
β-strand	8	1	37
β-strand	11-14	4	38
β-strand	23	1	37
β-strand	24-25	2	39
β-strand	26	1	36
β-strand	31	1	40
β-strand	38	1	40
β-strand	40-45	6	38
β-strand	52-55	4	38
β-strand	61	1	38
α-helix	62	1
β-strand	69-70	2	41
β-strand	78-79	2	39
β-strand	82-83	2	41
α-helix	88-90	3
β-strand	93-98	6	38
α-helix	105	1
β-strand	106	1	31
β-strand	107	1	38
β-strand	111-115	5	38
β-strand	120	1	42
β-strand	123-127	5	43
α-helix	128-130	3
α-helix	131-135	5
β-strand	138-140	3	44
β-strand	142-148	7	43
β-strand	149	1	42
β-strand	154-159	6	45
β-strand	162-163	2	45
β-strand	170	1	43
α-helix	171-173	3
β-strand	174-175	2	43
β-strand	181-185	5	43
β-strand	188-190	3	44
α-helix	191-196	6
β-strand	200-205	6	45
β-strand	211-215	5	45

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin alpha-E	A	protein	1176	Homo sapiens	P38570 (AlphaFold model)
Integrin beta-7	B	protein	776	Homo sapiens	P26010 (AlphaFold model)
Fab LF61 Heavy Chain	H	protein	220	Mus musculus
Fab LF61 Light Chain	L	protein	215	Mus musculus

Sequence of entity 1 (A), FASTA

>9P98_1 Integrin alpha-E (chains A)
MWLFHTLLCIASLALLAAFNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRT
KRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSS
ELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRAL
EKEEEEDKEEEEDEEEEEAGTEIAIILDGSGSIDPPDFQRAKDFISNMMRNFYEKCFECN
FALVQYGGVIQTEFDLRDSQDVMASLARVQNITQVGSVTKTASAMQHVLDSIFTSSHGSR
RKASKVMVVLTDGGIFEDPLNLTTVINSPKMQGVERFAIGVGEEFKSARTARELNLIASD
PDETHAFKVTNYMALDGLLSKLRYNIISMEGTVGDALHYQLAQIGFSAQILDERQVLLGA
VGAFDWSGGALLYDTRSRRGRFLNQTAAAAADAEAAQYSYLGYAVAVLHKTCSLSYIAGA
PRYKHHGAVFELQKEGREASFLPVLEGEQMGSYFGSELCPVDIDMDGSTDFLLVAAPFYH
VHGEEGRVYVYRLSEQDGSFSLARILSGHPGFTNARFGFAMAAMGDLSQDKLTDVAIGAP
LEGFGADDGASFGSVYIYNGHWDGLSASPSQRIRASTVAPGLQYFGMSMAGGFDISGDGL
ADITVGTLGQAVVFRSRPVVRLKVSMAFTPSALPIGFNGVVNVRLCFEISSVTTASESGL
REALLNFTLDVDVGKQRRRLQCSDVRSCLGCLREWSSGSQLCEDLLLMPTEGELCEEDCF
SNASVKVSYQLQTPEGQTDHPQPILDRYTEPFAIFQLPYEKACKNKLFCVAELQLATTVS
QQELVVGLTKELTLNINLTNSGEDSYMTSMALNYPRNLQLKRMQKPPSPNIQCDDPQPVA
SVLIMNCRIGHPVLKRSSAHVSVVWQLEENAFPNRTADITVTVTNSNERRSLANETHTLQ
FRHGFVAVLSKPSIMYVNTGQGLSHHKEFLFHVHGENLFGAEYQLQICVPTKLRGLQVVA
VKKLTRTQASTVCTWSQERACAYSSVQHVEEWHSVSCVIASDKENVTVAAEISWDHSEEL
LKDVTELQILGEISFNKSLYEGLNAENHRTKITVVFLKDEKYHGTGGLEVLFQGPGENAQ
CEKELQALEKENAQLEWELQALEKELAQWSHPQFEK

Sequence of entity 2 (B), FASTA

>9P98_2 Integrin beta-7 (chains B)
MVALPMVLVLLLVLSRGESELDAKIPSTGDATEWRNPHLSMLGSCQPAPSCQKCILSHPS
CAWCKQLNFTASGEAEARRCARREELLARGCPLEELEEPRGQQEVLQDQPLSQGARGEGA
TQLAPQRVRVTLRPGEPQQLQVRFLRAEGYPVDLYYLMDLSYSMKDDLERVRQLGHALLV
RLQEVTHSVRIGFGSFVDKTVLPFVSTVPSKLRHPCPTRLERCQSPFSFHHVLSLTGDAQ
AFEREVGRQSVSGNLDSPEGGFDAILQAALCQEQIGWRNVSRLLVFTSDDTFHTAGDGKL
GGIFMPSDGHCHLDSNGLYSRSTEFDYPSVGQVAQALSAANIQPIFAVTSAALPVYQELS
KLIPKSAVGELSEDSSNVVQLIMDAYNSLSSTVTLEHSSLPPGVHISYESQCEGPEKREG
KAEDRGQCNHVRINQTVTFWVSLQATHCLPEPHLLRLRALGFSEELIVELHTLCDCNCSD
TQPQAPHCSDGQGHLQCGVCSCAPGRLGRLCECSVAELSSPDLESGCRAPNGTGPLCSGK
GHCQCGRCSCSGQSSGHLCECDDASCERHEGILCGGFGRCQCGVCHCHANRTGRACECSG
DMDSCISPEGGLCSGHGRCKCNRCQCLDGYYGALCDQCPGCKTPCERHRDCAECGAFRTG
PLATNCSTACAHTNVTLALAPILDDGWCKERTLDNQLFFFLVEDDARGTVVLRVRPQEKG
ADHDTSGLEVLFQGPGKNAQCKKKLQALKKKNAQLKWKLQALKKKLAQGGHHHHHH

Sequence of entity 3 (H), FASTA

>9P98_3 Fab LF61 Heavy Chain (chains H)
MVQLQRAGPTIVKPGSAVKLSCKATGFAYEDYYIFWVRQREGGNGQKWIGRIHPGSGETK
YNDKFKGKATLTADTEASSAYMRLTSLTSEDTAVWYCGWERSVGRATFAYWGQGTSVTVS
SAKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQS
DLYTLSSSVTVPSSTWPSETVTCNVAHPASSTKVDKKIVP

Sequence of entity 4 (L), FASTA

>9P98_4 Fab LF61 Light Chain (chains L)
AAITFNLAPESLVVTAGSKVTFSCKASQDFLNSATKRNYLTWYQQRDGKPPKLLIYWASA
RLSGVPARFTGSGGGGTEFTLTISSVKAADIGTYYCRQLRSRPLTFGGGTKLTVKQPKSS
PSVTLFPPSSEELETNKATLVCTITDFYPGVVTVDWKVDGTPVTQGMETTQPSKQSNNKY
MASSYLTLTARAWERHSSYSCQVTHEGHTVEKSLS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	3
CA	Calcium ion	Ca	6

Primary citation

Molecular exaptation by the integrin alpha I domain. Hollis, J.A., Chan, M.C., Malik, H.S. et al. Sci Adv (2025) 11:eadx9567-eadx9567. DOI 10.1126/sciadv.adx9567 · PubMed

Other PDB entries of the same protein (UniProt P38570 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8ZJF 2.7 Å, Cryo-EM structure of human integrin alpha-E beta-7
9P97 2.92 Å, CryoEM structure of the closed integrin alphaEbeta7 bound to fab LF61
9P99 3.37 Å, CryoEM structure of integrin alphaEbeta7 bound to E-cadherin

Browse structure collections

About this viewer

MolViewer shows 9P98 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.