9PKX: Glycine receptor, alpha 1
Alpha1/Beta Heteromeric Glycine receptor in the presence of 0.200 mM strychnine and 500 nM ivermectin. Determined by electron microscopy at 2.86 Å resolution. Released 7 Jan 2026.
- Method
- Electron microscopy
- Resolution
- 2.86 Å
- Organism
- Danio rerio
- Chains
- 5
- Atoms
- 13,843
- Mol. weight
- 278.75 kDa
- Ligands
- NAG, SY9
- Released
- 7 Jan 2026
Explore 9PKX in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9PKX contains 55 α-helices and 72 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 11 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-42 | 9 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 1 |
| β-strand | 81-93 | 13 | 1 |
| α-helix | 95-97 | 3 | |
| β-strand | 106-108 | 3 | 1 |
| α-helix | 114-116 | 3 | |
| β-strand | 122-123 | 2 | 2 |
| β-strand | 127-131 | 5 | 1 |
| β-strand | 140-145 | 6 | 1 |
| β-strand | 149-161 | 13 | 1 |
| β-strand | 173-186 | 14 | 2 |
| β-strand | 190-194 | 5 | 1 |
| β-strand | 200-202 | 3 | 1 |
| β-strand | 211-213 | 3 | 2 |
| β-strand | 218-221 | 4 | 2 |
| β-strand | 224-225 | 2 | 2 |
| β-strand | 230-242 | 13 | 2 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-262 | 10 | |
| α-helix | 263-267 | 5 | |
| α-helix | 273-297 | 25 | |
| α-helix | 306-333 | 28 | |
| α-helix | 402-433 | 32 | |
Chain B: 11 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-42 | 9 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 8 |
| β-strand | 81-93 | 13 | 8 |
| α-helix | 95-97 | 3 | |
| β-strand | 106-109 | 4 | 8 |
| α-helix | 114-116 | 3 | |
| β-strand | 122-124 | 3 | 9 |
| β-strand | 127-131 | 5 | 8 |
| β-strand | 140-145 | 6 | 8 |
| β-strand | 149-161 | 13 | 8 |
| β-strand | 173-182 | 10 | 9 |
| β-strand | 190-194 | 5 | 8 |
| β-strand | 200-202 | 3 | 8 |
| β-strand | 211-213 | 3 | 9 |
| β-strand | 218-221 | 4 | 9 |
| β-strand | 224-225 | 2 | 10 |
| β-strand | 230-231 | 2 | 10 |
| β-strand | 233-242 | 10 | 9 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-262 | 10 | |
| α-helix | 263-267 | 5 | |
| α-helix | 273-297 | 25 | |
| α-helix | 306-333 | 28 | |
| α-helix | 400-434 | 35 | |
Chain C: 11 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 34-41 | 8 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 6 |
| β-strand | 81-93 | 13 | 6 |
| α-helix | 95-97 | 3 | |
| β-strand | 106-108 | 3 | 6 |
| α-helix | 111-116 | 6 | |
| β-strand | 122-124 | 3 | 7 |
| β-strand | 127-132 | 6 | 6 |
| β-strand | 140-145 | 6 | 6 |
| β-strand | 149-161 | 13 | 6 |
| β-strand | 173-186 | 14 | 7 |
| β-strand | 190-194 | 5 | 6 |
| β-strand | 200-202 | 3 | 6 |
| β-strand | 211-213 | 3 | 7 |
| β-strand | 218-221 | 4 | 7 |
| β-strand | 224-225 | 2 | 7 |
| β-strand | 230-242 | 13 | 7 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-262 | 10 | |
| α-helix | 263-266 | 4 | |
| α-helix | 273-294 | 22 | |
| α-helix | 306-333 | 28 | |
| α-helix | 403-434 | 32 | |
Chain D: 12 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 36-41 | 6 | |
| α-helix | 53 | 1 | |
| α-helix | 60 | 1 | |
| β-strand | 61-76 | 16 | 3 |
| β-strand | 81-93 | 13 | 3 |
| α-helix | 95-97 | 3 | |
| β-strand | 106-109 | 4 | 3 |
| α-helix | 114-116 | 3 | |
| β-strand | 122-124 | 3 | 4 |
| β-strand | 127-132 | 6 | 3 |
| β-strand | 140-145 | 6 | 3 |
| β-strand | 149-161 | 13 | 3 |
| β-strand | 173-182 | 10 | 4 |
| β-strand | 190-194 | 5 | 3 |
| β-strand | 200-202 | 3 | 3 |
| β-strand | 211-221 | 11 | 4 |
| β-strand | 224-225 | 2 | 5 |
| β-strand | 230-231 | 2 | 5 |
| β-strand | 233-242 | 10 | 4 |
| α-helix | 245-247 | 3 | |
| α-helix | 248-252 | 5 | |
| α-helix | 253-262 | 10 | |
| α-helix | 263-266 | 4 | |
| α-helix | 273-294 | 22 | |
| α-helix | 306-332 | 27 | |
| α-helix | 402-435 | 34 | |
Chain E: 10 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 56-63 | 8 | |
| α-helix | 79 | 1 | |
| β-strand | 80-95 | 16 | 11 |
| β-strand | 100-112 | 13 | 11 |
| β-strand | 126-128 | 3 | 11 |
| α-helix | 131-136 | 6 | |
| β-strand | 142-144 | 3 | 12 |
| β-strand | 147-152 | 6 | 11 |
| β-strand | 160-165 | 6 | 11 |
| β-strand | 169-181 | 13 | 11 |
| β-strand | 193-202 | 10 | 12 |
| β-strand | 210-214 | 5 | 11 |
| β-strand | 220-222 | 3 | 11 |
| β-strand | 230-232 | 3 | 12 |
| β-strand | 237-239 | 3 | 12 |
| β-strand | 244-245 | 2 | 13 |
| β-strand | 251-252 | 2 | 13 |
| β-strand | 254-263 | 10 | 12 |
| α-helix | 266-268 | 3 | |
| α-helix | 269-273 | 5 | |
| α-helix | 274-283 | 10 | |
| α-helix | 284-288 | 5 | |
| α-helix | 294-318 | 25 | |
| α-helix | 327-354 | 28 | |
| α-helix | 469-493 | 25 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Glycine receptor, alpha 1 | A, B, C, D | protein | 458 | Danio rerio | B3DHZ5 (AlphaFold model) |
| Glycine receptor beta subunit 2 | E | protein | 591 | Danio rerio | Q6DC22 (AlphaFold model) |
Sequence of entity 1 (A, B, C, D), FASTA
>9PKX_1 Glycine receptor, alpha 1 (chains A, B, C, D)
MFALGIYLWETIVFFSLAASQQAAARKAASPMPPSEFLDKLMGKVSGYDARIRPNFKGPP
VNVTCNIFINSFGSIAETTMDYRVNIFLRQQWNDPRLAYSEYPDDSLDLDPSMLDSIWKP
DLFFANEKGANFHEVTTDNKLLRISKNGNVLYSIRITLVLACPMDLKNFPMDVQTCIMQL
ESFGYTMNDLIFEWDEKGAVQVADGLTLPQFILKEEKDLRYCTKHYNTGKFTCIEARFHL
ERQMGYYLIQMYIPSLLIVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPK
VSYVKAIDIWMAVCLLFVFSALLEYAAVNFIARQHKELLRFQRRRRHLKEDEAGDGRFSF
AAYGMGPACLQAKDGMAIKGNNNNAPTSTNPPEKTVEEMRKLFISRAKRIDTVSRVAFPL
VFLIFNIFYWITYKIIRSEDIHKQLVPRGSHHHHHHHH
Sequence of entity 2 (E), FASTA
>9PKX_2 Glycine receptor beta subunit 2 (chains E)
MKALKVIFMLLIICLWMEGGFTKEKSAKKWSHPQFEKGGGSGGGSGGGSWSHPQFEKGGG
SGGGSGGGSWSHPQFEKGGGSGGGSGGGSWSHPQFEKENLYFQGEKSAKKGKKKGKQVYC
PSQLSSEDLARVPANSTSNILNKLLITYDPRIRPNFKGIPVEDRVNIFINSFGSIQETTM
DYRVNIFLRQRWNDPRLRLPQDFKSDSLTVDPKMFKCLWKPDLFFANEKSANFHDVTQEN
ILLFIFRNGDVLISMRLSVTLSCPLDLTLFPMDTQRCKMQLESFGYTTDDLQFMWQSGDP
VQMDEIALPQFDIKQEDIEYGNCTKYYAGTGYYTCVEVIFTLRRQVGFYMMGVYAPTLLI
VVLSWLSFWINPDASAARVPLGILSVLSLSSECTSLASELPKVSYVKAIDIWLIACLLFG
FASLVEYAVVQVMLNSPKLLEAERAKIATKEKAEGKTPAKNTINGMGSTPIHVSTLQVTE
TRCKKVCTSKSDLRTNDFSIVGSLPRDFELSNFDCYGKPIEVGSAFSKSQAKNNKKPPPP
KPVIPSAAKRIDLYARALFPFSFLFFNVIYWSVYLENLYFQGTETSQVAPA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 5 |
| SY9 | Strychnine | C21 H22 N2 O2 | 5 |
Primary citation
Structural basis for domain coupling in heteromeric glycine receptors revealed by an atypical allosteric agonist. Gibbs, E., Feddersen, B., Kindig, K.J. et al. Sci Adv (2026) 12:eaeb2036-eaeb2036. DOI 10.1126/sciadv.aeb2036 · PubMed
Other PDB entries of the same protein (UniProt B3DHZ5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9PKW 2.86 Å, Alpha1/Beta Heteromeric Glycine receptor in the presence of 0.200 mM strychnine and 200…
- 9PKY 2.89 Å, Alpha1/Beta Heteromeric Glycine receptor in the presence of 0.200 mM strychnine and 2000…
- 9PKZ 2.89 Å, Alpha1/Beta Heteromeric Glycine receptor in the presence of 0.200 mM strychnine and 0.02…
Browse structure collections
About this viewer
MolViewer shows 9PKX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.