9PW8: Fem-1 homolog B

Name: PDB 9PW8: Fem-1 homolog B (FEM1B) in complex with VU0417412
Published: 2025-11-26
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Fem-1 homolog B (FEM1B) in complex with VU0417412. Determined by X-ray diffraction at 2.8 Å resolution. Released 26 Nov 2025.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,034
Mol. weight: 79.03 kDa
Ligands: A1CLY
Released: 26 Nov 2025

Explore 9PW8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9PW8 contains 41 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-14	13
α-helix	17-24	8
α-helix	29-37	9
β-strand	40-41	2	1
β-strand	46-47	2	1
α-helix	49-55	7
α-helix	59-67	9
β-strand	76-80	5	1
β-strand	85-90	6	1
α-helix	91-97	7
α-helix	101-109	9
α-helix	124-131	8
α-helix	134-141	8
α-helix	157-163	7
α-helix	167-175	9
α-helix	190-196	7
α-helix	200-207	8
α-helix	222-228	7
α-helix	232-238	7
α-helix	248-262	15
α-helix	269-279	11
α-helix	294-297	4
β-strand	301	1	2
β-strand	303	1	2
α-helix	311-316	6
α-helix	321-335	15

Chain B: 21 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	17-24	8
α-helix	29-35	7
β-strand	40-42	3	3
β-strand	45-47	3	3
α-helix	49-55	7
α-helix	59-67	9
β-strand	76-81	6	3
β-strand	84-90	7	3
α-helix	91-97	7
α-helix	101-109	9
α-helix	124-131	8
α-helix	134-141	8
α-helix	157-164	8
α-helix	167-175	9
α-helix	190-196	7
α-helix	200-208	9
α-helix	222-228	7
α-helix	232-238	7
α-helix	247-262	16
α-helix	269-281	13
α-helix	294-297	4
β-strand	301	1	4
β-strand	303	1	4
α-helix	311-316	6
α-helix	317-319	3
α-helix	321-335	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein fem-1 homolog B	A, B	protein	357	Homo sapiens	Q9UK73 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9PW8_1 Protein fem-1 homolog B (chains A, B)
GHMEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGH
AKVVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTT
VTNSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRA
DPNAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELL
LSHADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPP
IHAYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGGGGSGGGSKKRLLLGLDR

Ligands and cofactors

ID	Name	Formula	Copies
A1CLY	N-(4-fluorophenyl)thiophene-2-carboxamide	C11 H8 F N O S	2

Primary citation

Nuclear Magnetic Resonance-based fragment screen of the E3 ligase Fem-1 homolog B. Katinas, J.M., Amporndanai, K., Taylor, A.J. et al. Protein Sci (2025) 34:e70365-e70365. DOI 10.1002/pro.70365 · PubMed

Other PDB entries of the same protein (UniProt Q9UK73 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7EL6 2.8 Å, Structure of SMCR8 bound FEM1B
9PQA 2.9 Å, Fem-1 homolog B (FEM1B) in complex with VU0432623
9PQ9 2.93 Å, Fem-1 homolog B (FEM1B) in complex with VU0421763
9PWJ 3.0 Å, Fem-1 homolog B (FEM1B) in complex with VU0081201
9PXP 3.0 Å, Fem-1 homolog B (FEM1B) in complex with VU0416476
9PXO 3.05 Å, Fem-1 homolog B (FEM1B) in complex with VU0023775
9PQE 3.1 Å, Fem-1 homolog B (FEM1B) in complex with VU0412674
6LBF 3.25 Å, Crystal structure of FEM1B
8WQF 3.27 Å, cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CUX1…
8WQB 3.37 Å, Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CCDC89…
8WQE 3.38 Å, Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CUX1…
8WQA 3.39 Å, Cryo-EM structure of CUL2-RBX1-ELOB-ELOC-FEM1B bound with the C-degron of CCDC89…

Browse structure collections

About this viewer

MolViewer shows 9PW8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.