7EL6: SMCR8 bound FEM1B

Structure of SMCR8 bound FEM1B. Determined by X-ray diffraction at 2.8 Å resolution. Released 12 May 2021.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,229
Mol. weight: 78.6 kDa
Released: 12 May 2021

Explore 7EL6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EL6 contains 46 α-helices and 10 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	4-14	11
α-helix	17-24	8
α-helix	29-36	8
β-strand	40-41	2	1
β-strand	46-47	2	1
α-helix	49-56	8
α-helix	59-63	5
α-helix	64-68	5
α-helix	69	1
β-strand	76-81	6	2
β-strand	84-90	7	2
α-helix	91-97	7
α-helix	101-109	9
α-helix	124-131	8
α-helix	134-142	9
α-helix	157-163	7
α-helix	167-175	9
α-helix	190-197	8
α-helix	200-208	9
α-helix	211-213	3
α-helix	222-228	7
α-helix	232-241	10
α-helix	246-259	14
α-helix	269-283	15
α-helix	292-297	6
α-helix	298-300	3
α-helix	311-315	5
α-helix	321-336	16
α-helix	348-354	7

Chain B: 21 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	2-13	12
α-helix	17-24	8
α-helix	29-35	7
β-strand	40-42	3	3
β-strand	45-47	3	3
α-helix	49-55	7
α-helix	59-63	5
α-helix	64-68	5
β-strand	77-81	5	3
β-strand	84-89	6	3
α-helix	91-97	7
α-helix	101-109	9
α-helix	124-131	8
α-helix	134-142	9
α-helix	157-163	7
α-helix	167-175	9
α-helix	190-197	8
α-helix	200-208	9
α-helix	222-228	7
α-helix	232-241	10
α-helix	247-259	13
α-helix	269-283	15
β-strand	302	1	4
β-strand	305	1	4
α-helix	311-315	5
α-helix	321-335	15
α-helix	348-354	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein fem-1 homolog B,Guanine nucleotide exchange protein SMCR8	A, B	protein	357	Homo sapiens	Q8TEV9 (AlphaFold model), Q9UK73 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7EL6_1 Protein fem-1 homolog B,Guanine nucleotide exchange protein SMCR8 (chains A, B)
MEGLAGYVYKAASEGKVLTLAALLLNRSESDIRYLLGYVSQQGGQRSTPLIIAARNGHAK
VVRLLLEHYRVQTQQTGTVRFDGYVIDGATALWCAAGAGHFEVVKLLVSHGANVNHTTVT
NSTPLRAACFDGRLDIVKYLVENNANISIANKYDNTCLMIAAYKGHTDVVRYLLEQRADP
NAKAHCGATALHFAAEAGHIDIVKELIKWRAAIVVNGHGMTPLKVAAESCKADVVELLLS
HADCDRRSRIEALELLGASFANDRENYDIIKTYHYLYLAMLERFQDGDNILEKEVLPPIH
AYGNRTECRNPQELESIRQDRDALHMEGLIVRERILGGGGSGGGSGSQKWKLIGLQR

Primary citation

Structural insights into SMCR8 C-degron recognition by FEM1B. Zhao, S., Ru, W., Chen, X. et al. Biochem Biophys Res Commun (2021) 557:236-239. DOI 10.1016/j.bbrc.2021.04.046 · PubMed

Other PDB entries of the same protein (UniProt Q8TEV9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9LUA 1.97 Å, Crystal structure of FIP200 Claw domain and SMCR8 FIR motif complex
6LT0 3.2 Å, cryo-EM structure of C9ORF72-SMCR8-WDR41
6V4U 3.8 Å, Cryo-EM structure of SMCR8-C9orf72-WDR41 complex
7O2W 3.8 Å, Structure of the C9orf72-SMCR8 complex
7MGE 3.94 Å, Structure of C9orf72:SMCR8:WDR41 in complex with ARF1

Browse structure collections

About this viewer

MolViewer shows 7EL6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.