High-resolution structure of RNF38 RING domain. Determined by X-ray diffraction at 1.2 Å resolution. Released 30 Jul 2025.
Explore 9Q88 in 3D Show helices and sheets RCSB PDB PDBe
9Q88 contains 3 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 392-394 | 3 | |
| α-helix | 396-397 | 2 | |
| β-strand | 398-400 | 3 | 1 |
| β-strand | 412-413 | 2 | 2 |
| β-strand | 418-419 | 2 | 2 |
| β-strand | 425-428 | 4 | 1 |
| β-strand | 434-436 | 3 | 1 |
| α-helix | 437-447 | 11 | |
| β-strand | 449 | 1 | 3 |
| β-strand | 456 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase RNF38 | A | protein | 79 | Homo sapiens | Q9H0F5 (AlphaFold model) |
>9Q88_1 E3 ubiquitin-protein ligase RNF38 (chains A) GSTKADIEQLPSYRFNPNNHQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKA NRTCPICRADASEVHRDSE
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Tuning ubiquitin transfer by RING E3 ubiquitin ligases through the linchpin residue. Nakasone, M.A., Buetow, L., Gabrielsen, M. et al. Life Sci Alliance (2025) 8. DOI 10.26508/lsa.202503394 · PubMed
Other PDB entries of the same protein (UniProt Q9H0F5 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9Q88 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.