9QAL: Arkadia 2 RING domain

Solution NMR structure of Arkadia 2 RING domain. Determined by solution NMR. Released 11 Mar 2026.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 535
Mol. weight: 7.87 kDa
Ligands: ZN
Released: 11 Mar 2026

Explore 9QAL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QAL contains 1 α-helix and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 2 β-strands

Element	Residues	Length	Sheet
β-strand	29-30	2	1
β-strand	38-39	2	1
α-helix	40-49	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase ARK2C	A	protein	68	Homo sapiens	Q6ZSG1 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9QAL_1 E3 ubiquitin-protein ligase ARK2C (chains A)
KGKKDEGEESDTDEKCTICLSMLEDGEDVRRLPCMHLFHQLCVDQWLAMSKKCPICRVDI
ETQLGADS

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Mechanistic insights into the Auto-ubiquitiniation of ARKADIA 2C RING domain. Marousis, K.D., Politi, M.D., Giannari, D. et al. To be published.

Other PDB entries of the same protein (UniProt Q6ZSG1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5D0I 1.9 Å, Structure of RING finger protein 165
5D0M 1.91 Å, Structure of UbE2D2:RNF165:Ub complex
5ULH 1.95 Å, Structure of RNF165 in complex with a UbcH5b~Ub conjugate
9N1F 2.1 Å, Crystal Structure of the Ark2C-Ubc13~Ub-Mms2 complex
5ULK 2.38 Å, Crystal Structure of RNF165 in complex with a UbcH5b~Ub conjugate
7R70 2.5 Å, Crystal Structure of the UbArk2C fusion protein
5D0K 2.65 Å, Structure of UbE2D2:RNF165:Ub complex
7R71 2.8 Å, Crystal Structure of the UbArk2C-UbcH5b~Ub complex

Browse structure collections

About this viewer

MolViewer shows 9QAL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.