9QC6: EIF2B decamer

Structure of eIF2B decamer bound to (P)eIF2 alpha and Compound A-(S). Determined by electron microscopy at 2.83 Å resolution. Released 13 May 2026.

Method: Electron microscopy
Resolution: 2.83 Å
Organism: Homo sapiens
Chains: 11
Atoms: 24,390
Mol. weight: 556.73 kDa
Ligands: A1I5O
Released: 13 May 2026

Explore 9QC6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QC6 contains 155 α-helices and 217 β-strands across 11 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 16 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
α-helix	22-35	14
α-helix	42-49	8
α-helix	50-58	9
α-helix	64-76	13
α-helix	86-115	30
α-helix	116-118	3
β-strand	123-128	6	1
α-helix	132-143	12
β-strand	148-153	6	1
α-helix	160-168	9
α-helix	169-171	3
β-strand	175-178	4	1
α-helix	183-186	4
β-strand	192-195	4	1
β-strand	199-200	2	2
β-strand	206-209	4	2
α-helix	212-221	10
β-strand	226-229	4	1
α-helix	232-234	3
β-strand	235	1	2
α-helix	248-251	4
β-strand	273-276	4	2
α-helix	278-280	3
β-strand	283-286	4	1
β-strand	289-291	3	1
α-helix	293-303	11

Chain B: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	6-16	11
α-helix	22-35	14
α-helix	42-59	18
α-helix	63-78	16
α-helix	90-115	26
α-helix	116-118	3
β-strand	123-128	6	3
α-helix	132-143	12
β-strand	148-153	6	3
α-helix	160-169	10
β-strand	175	1	3
β-strand	178	1	3
α-helix	180-182	3
α-helix	183-186	4
β-strand	192-195	4	3
β-strand	199-200	2	4
β-strand	206-209	4	4
α-helix	212-222	11
β-strand	226-229	4	3
α-helix	232-234	3
β-strand	235	1	4
α-helix	243-245	3
α-helix	248-251	4
β-strand	273-276	4	4
α-helix	278-280	3
β-strand	283-286	4	3
β-strand	289-291	3	3
α-helix	293-303	11

Chain C: 22 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	11-23	13
α-helix	31-47	17
α-helix	54-71	18
α-helix	76-95	20
α-helix	129-152	24
α-helix	155-157	3
β-strand	164-168	5	5
α-helix	172-184	13
β-strand	188-192	5	5
α-helix	199-208	10
β-strand	213-217	5	5
α-helix	219-221	3
α-helix	222-226	5
β-strand	231-234	4	5
β-strand	239	1	6
β-strand	245	1	6
α-helix	247	1
β-strand	248	1	7
α-helix	251-261	11
β-strand	265-268	4	5
α-helix	271-273	3
β-strand	274	1	6
α-helix	279-281	3
α-helix	287	1
β-strand	288	1	8
α-helix	291-293	3
α-helix	297-299	3
α-helix	301-304	4
β-strand	306-308	3	9
β-strand	311	1	8
β-strand	313	1	7
β-strand	316	1	6
α-helix	318-320	3
β-strand	323-325	3	5
β-strand	330-331	2	5
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain D: 20 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	10-23	14
α-helix	31-48	18
α-helix	54-71	18
α-helix	76-96	21
α-helix	129-145	17
α-helix	147-152	6
α-helix	155-158	4
β-strand	164-168	5	10
α-helix	172-184	13
β-strand	188-192	5	10
α-helix	200-209	10
β-strand	214-217	4	10
α-helix	219-221	3
α-helix	222-225	4
α-helix	226-228	3
β-strand	231-234	4	10
β-strand	238-239	2	11
β-strand	245-248	4	11
α-helix	251-261	11
β-strand	265-268	4	10
α-helix	271-273	3
β-strand	274	1	11
β-strand	288	1	12
α-helix	297-299	3
α-helix	301-305	5
β-strand	306-308	3	13
β-strand	311	1	12
β-strand	313-316	4	11
α-helix	318-320	3
β-strand	323-326	4	10
β-strand	329-331	3	10
α-helix	333-335	3
α-helix	336-343	8
α-helix	346-348	3

Chain E: 5 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	14
α-helix	37-44	8
β-strand	51-52	2	14
β-strand	75-76	2	14
β-strand	101-104	4	14
α-helix	115-124	10
β-strand	128-133	6	14
β-strand	157-161	5	14
β-strand	166-171	6	14
β-strand	179-183	5	15
α-helix	184-189	6
β-strand	192-197	6	14
β-strand	200-207	8	14
α-helix	209-217	9
α-helix	228-231	4
β-strand	263-266	4	14
β-strand	364	1	16
β-strand	368	1	17
β-strand	380	1	18
β-strand	381	1	16
β-strand	385	1	17
β-strand	392	1	19
β-strand	396-398	3	18
β-strand	403	1	20
β-strand	409	1	19
β-strand	413-415	3	18
β-strand	420	1	20
β-strand	421	1	21
β-strand	426	1	19
β-strand	431	1	18
β-strand	437	1	21

Chain F: 8 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	22
β-strand	7	1	23
α-helix	37-45	9
β-strand	53	1	23
α-helix	62-70	9
β-strand	77	1	23
α-helix	88-93	6
β-strand	100	1	22
β-strand	101-103	3	24
β-strand	104	1	23
α-helix	115-123	9
β-strand	128-131	4	24
β-strand	157-160	4	25
β-strand	166	1	24
β-strand	167-171	5	25
β-strand	179-183	5	26
α-helix	184-189	6
β-strand	192-196	5	25
α-helix	199-201	3
β-strand	205-207	3	24
α-helix	209-217	9
α-helix	225-228	4
β-strand	263-266	4	24
β-strand	352-354	3	27
β-strand	369-371	3	27
β-strand	374	1	28
β-strand	380-381	2	29
β-strand	385	1	30
β-strand	391	1	28
β-strand	396-398	3	29
β-strand	402	1	30
β-strand	408	1	28
β-strand	413-415	3	29
β-strand	419-420	2	31
β-strand	432	1	29
β-strand	435-436	2	31

Chain G: 19 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	185	1	32
α-helix	205-216	12
α-helix	222-238	17
α-helix	248-266	19
α-helix	268-270	3
α-helix	271-286	16
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-326	13
β-strand	332-336	5	9
α-helix	340-351	12
β-strand	357-362	6	9
α-helix	369-378	10
β-strand	383-387	5	9
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	9
β-strand	407-408	2	33
β-strand	414-417	4	33
α-helix	419-429	11
β-strand	434-437	4	9
α-helix	440-442	3
β-strand	443	1	33
β-strand	457	1	32
α-helix	460-463	4
β-strand	482-484	3	5
β-strand	487	1	32
β-strand	489-492	4	33
α-helix	494-496	3
β-strand	499-502	4	9
β-strand	505-507	3	9
α-helix	509-511	3
α-helix	512-516	5

Chain H: 19 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	185	1	34
α-helix	205-216	12
α-helix	222-238	17
α-helix	242-243	2
α-helix	248-266	19
α-helix	271-285	15
α-helix	293-308	16
α-helix	309-313	5
α-helix	314-324	11
β-strand	332-336	5	13
α-helix	340-352	13
β-strand	357-362	6	13
α-helix	369-378	10
β-strand	383-387	5	13
α-helix	388-390	3
α-helix	391-394	4
α-helix	395-397	3
β-strand	400-404	5	13
β-strand	407-408	2	35
β-strand	414-417	4	35
α-helix	420-429	10
β-strand	434-437	4	13
α-helix	440-442	3
β-strand	443	1	35
β-strand	457	1	34
α-helix	460-462	3
β-strand	467	1	36
β-strand	470	1	36
β-strand	482-484	3	10
β-strand	487	1	34
β-strand	489-492	4	35
α-helix	494-496	3
β-strand	499-501	3	13
β-strand	506-507	2	13
α-helix	509-511	3
α-helix	512-516	5

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Translation initiation factor eIF2B subunit alpha	A, B	protein	326	Homo sapiens	Q14232 (AlphaFold model)
Translation initiation factor eIF2B subunit beta	C, D	protein	351	Homo sapiens	P49770 (AlphaFold model)
Translation initiation factor eIF-2B subunit gamma	E, F	protein	452	Homo sapiens	Q9NR50 (AlphaFold model)
Translation initiation factor eIF-2B subunit delta	G, H	protein	523	Homo sapiens	Q9UI10 (AlphaFold model)
Translation initiation factor eIF2B subunit epsilon	I, J	protein	742	Homo sapiens	Q13144
Eukaryotic translation initiation factor 2 subunit 1	K	protein	210	Homo sapiens	P05198

Sequence of entity 1 (A, B), FASTA

>9QC6_1 Translation initiation factor eIF2B subunit alpha (chains A, B)
MGSSHHHHHHSSGLEVLFQGPMDDKELIEYFKSQMKEDPDMASAVAAIRTLLEFLKRDKG
ETIQGLRANLTSAIETLCGVDSSVAVSSGGELFLRFISLASLEYSDYSKCKKIMIERGEL
FLRRISLSRNKIADLCHTFIKDGATILTHAYSRVVLRVLEAAVAAKKRFSVYVTESQPDL
SGKKMAKALCHLNVPVTVVLDAAVGYIMEKADLVIVGAEGVVENGGIINKIGTNQMAVCA
KAQNKPFYVVAESFKFVRLFPLNQQDVPDKFKYKADTLKVAQTGQDLKEEHPWVDYTAPS
LITLLFTDLGVLTPSAVSDELIKLYL

Sequence of entity 2 (C, D), FASTA

>9QC6_2 Translation initiation factor eIF2B subunit beta (chains C, D)
MPGSAAKGSELSERIESFVETLKRGGGPRSSEEMARETLGLLRQIITDHRWSNAGELMEL
IRREGRRMTAAQPSETTVGNMVRRVLKIIREEYGRLHGRSDESDQQESLHKLLTSGGLNE
DFSFHYAQLQSNIIEAINELLVELEGTMENIAAQALEHIHSNEVIMTIGFSRTVEAFLKE
AARKRKFHVIVAECAPFCQGHEMAVNLSKAGIETTVMTDAAIFAVMSRVNKVIIGTKTIL
ANGALRAVTGTHTLALAAKHHSTPLIVCAPMFKLSPQFPNEEDSFHKFVAPEEVLPFTEG
DILEKVSVHCPVFDYVPPELITLFISNIGGNAPSYIYRLMSELYHPDDHVL

Sequence of entity 3 (E, F), FASTA

>9QC6_3 Translation initiation factor eIF-2B subunit gamma (chains E, F)
MEFQAVVMAVGGGSRMTDLTSSIPKPLLPVGNKPLIWYPLNLLERVGFEEVIVVTTRDVQ
KALCAEFKMKMKPDIVCIPDDADMGTADSLRYIYPKLKTDVLVLSCDLITDVALHEVVDL
FRAYDASLAMLMRKGQDSIEPVPGQKGKKKAVEQRDFIGVDSTGKRLLFMANEADLDEEL
VIKGSILQKHPRIRFHTGLVDAHLYCLKKYIVDFLMENGSITSIRSELIPYLVRKQFSSA
SSQQGQEEKEEDLKKKELKSLDIYSFIKEANTLNLAPYDACWNACRGDRWEDLSRSQVRC
YVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVGVDSLIGP
ETQIGEKSSIKRSVIGSSCLIKDRVTITNCLLMNSVTVEEGSNIQGSVICNNAVIEKGAD
IKDCLIGSGQRIEAKAKRVNEVIVGNDQLMEI

Sequence of entity 4 (G, H), FASTA

>9QC6_4 Translation initiation factor eIF-2B subunit delta (chains G, H)
MAAVAVAVREDSGSGMKAELPPGPGAVGREMTKEEKLQLRKEKKQQKKKRKEEKGAEPET
GSAVSAAQCQVGPTRELPESGIQLGTPREKVPAGRSKAELRAERRAKQEAERALKQARKG
EQGGPPPKASPSTAGETPSGVKRLPEYPQVDDLLLRRLVKKPERQQVPTRKDYGSKVSLF
SHLPQYSRQNSLTQFMSIPSSVIHPAMVRLGLQYSQGLVSGSNARCIALLRALQQVIQDY
TTPPNEELSRDLVNKLKPYMSFLTQCRPLSASMHNAIKFLNKEITSVGSSKREEEAKSEL
RAAIDRYVQEKIVLAAQAISRFAYQKISNGDVILVYGCSSLVSRILQEAWTEGRRFRVVV
VDSRPWLEGRHTLRSLVHAGVPASYLLIPAASYVLPEVSKVLLGAHALLANGSVMSRVGT
AQLALVARAHNVPVLVCCETYKFCERVQTDAFVSNELDDPDDLQCKRGEHVALANWQNHA
SLRLLNLVYDVTPPELVDLVITELGMIPCSSVPVVLRVKSSDQ

Sequence of entity 5 (I, J), FASTA

>9QC6_5 Translation initiation factor eIF2B subunit epsilon (chains I, J)
MGSSHHHHHHSSGLEVLFQGPMAAPVVAPPGVVVSRANKRSGAGPGGSGGGGARGAEEEP
PPPLQAVLVADSFDRRFFPISKDQPRVLLPLANVALIDYTLEFLTATGVQETFVFCCWKA
AQIKEHLLKSKWCRPTSLNVVRIITSELYRSLGDVLRDVDAKALVRSDFLLVYGDVISNI
NITRALEEHRLRRKLEKNVSVMTMIFKESSPSHPTRCHEDNVVVAVDSTTNRVLHFQKTQ
GLRRFAFPLSLFQGSSDGVEVRYDLLDCHISICSPQVAQLFTDNFDYQTRDDFVRGLLVN
EEILGNQIHMHVTAKEYGARVSNLHMYSAVCADVIRRWVYPLTPEANFTDSTTQSCTHSR
HNIYRGPEVSLGHGSILEENVLLGSGTVIGSNCFITNSVIGPGCHIGDNVVLDQTYLWQG
VRVAAGAQIHQSLLCDNAEVKERVTLKPRSVLTSQVVVGPNITLPEGSVISLHPPDAEED
EDDGEFSDDSGADQEKDKVKMKGYNPAEVGAAGKGYLWKAAGMNMEEEEELQQNLWGLKI
NMEEESESESEQSMDSEEPDSRGGSPQMDDIKVFQNEVLGTLQRGKEENISCDNLVLEIN
SLKYAYNISLKEVMQVLSHVVLEFPLQQMDSPLDSSRYCALLLPLLKAWSPVFRNYIKRA
ADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRK
NQQLQRFIQWLKEAEEESSEDD

Sequence of entity 6 (K), FASTA

>9QC6_6 Eukaryotic translation initiation factor 2 subunit 1 (chains K)
GSMPGLSCRFYQHKFPEVEDVVMVNVRSIAEMGAYVSLLEYNNIEGMILLSELSRRRIRS
INKLIRIGRNECVVVIRVDKEKGYIDLSKRRVSPEEAIKCEDKFTKSKTVYSILRHVAEV
LEYTKDEQLESLFQRTAWVFDDKYKRPGYGAYDAFKHAVSDPSILDSLDLNEDEREVLIN
NINRRLTPQLERAPGGLNDIFEAQKIEWHE

Ligands and cofactors

ID	Name	Formula	Copies
A1I5O	~{N}-[(1~{S})-7-[3-[[ethanoyl(methyl)amino]methyl]phenyl]-5-(trifluoromethyl)-1…	C30 H37 F4 N3 O3	1

Primary citation

A molecular stabiliser of an inhibitory eIF2B-eIF2( alpha P) complex activates the Integrated Stress Response. Shilliday, F., Gancedo-Rodrigo, M., George, G. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-72688-y · PubMed

Other PDB entries of the same protein (UniProt Q14232 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y4B 2.1 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9ZUZ 2.25 Å, Translation Initiation Factor eIF-2B complex with the Isohexide Diamine GSK735
7VLK 2.27 Å, eIF2B-SFSV NSs C2-imposed
9Y3U 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
9Y4W 2.4 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7F64 2.42 Å, eIF2B-SFSV NSs
9Y3T 2.5 Å, Eukaryotic translation initiation factor 2-B (eIF2B) with a truncation in the beta…
7RLO 2.6 Å, Structure of the human eukaryotic translation initiation factor 2B (eIF2B) in complex…
3ECS 2.65 Å, Crystal structure of human eIF2B alpha
7KMA 2.7 Å, Crystal structure of eif2Balpha with a ligand.
9HVE 2.7 Å, Native human eIF2-eIF2B complex
7F66 2.76 Å, eIF2B-SFSV NSs-1-eIF2

Browse structure collections

About this viewer

MolViewer shows 9QC6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.