9QFH: PDB entry 9QFH

The composite map of of the AMPAR complex GluA3- TARP gamma2 in the apo state. Determined by electron microscopy at 2.9 Å resolution. Released 9 Jul 2025.

Method: Electron microscopy
Resolution: 2.9 Å
Organism: Rattus norvegicus
Chains: 8
Atoms: 29,625
Mol. weight: 1053.69 kDa
Released: 9 Jul 2025

Explore 9QFH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9QFH contains 164 α-helices and 174 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 37 helices, 39 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	1
α-helix	18-31	14
β-strand	42-49	8	1
α-helix	55-68	14
β-strand	72-75	4	1
α-helix	82-91	10
β-strand	95-98	4	1
α-helix	101-103	3
β-strand	110-112	3	1
α-helix	115-116	2
α-helix	118-128	11
β-strand	132-137	6	2
α-helix	144-156	13
β-strand	159-164	6	2
α-helix	171-183	13
β-strand	188-192	5	2
α-helix	195-208	14
β-strand	216-219	4	2
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	2
α-helix	250-259	10
α-helix	277-298	22
α-helix	318-320	3
α-helix	321-330	10
β-strand	335-337	3	3
β-strand	340-342	3	3
β-strand	344	1	4
β-strand	350	1	4
β-strand	355-360	6	2
β-strand	365-371	7	2
β-strand	378-379	2	2
β-strand	398-401	4	5
β-strand	404	1	6
β-strand	408	1	6
β-strand	409-410	2	7
α-helix	414-416	3
α-helix	419-422	4
β-strand	423-424	2	7
α-helix	426-437	12
β-strand	443-446	4	5
β-strand	455	1	8
β-strand	462	1	8
α-helix	464-470	7
β-strand	476-477	2	5
β-strand	482	1	9
α-helix	485-488	4
β-strand	491-493	3	5
β-strand	498-500	3	9
β-strand	502-507	6	10
α-helix	518-520	3
β-strand	523	1	11
α-helix	525-547	23
α-helix	550-553	4
α-helix	577-588	12
α-helix	600-633	34
α-helix	640-645	6
β-strand	650-652	3	10
β-strand	654	1	12
α-helix	658-665	8
α-helix	669-680	12
β-strand	687	1	12
α-helix	690-699	10
β-strand	704-709	6	10
α-helix	710-717	8
β-strand	724-727	4	10
β-strand	734-736	3	9
β-strand	739-741	3	5
α-helix	747-759	13
α-helix	762-768	7
α-helix	769-773	5
α-helix	790	1
β-strand	791	1	13
α-helix	792	1
α-helix	793-795	3
α-helix	797-827	31

Chain B: 35 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	14
α-helix	17-31	15
β-strand	42-49	8	14
α-helix	55-68	14
β-strand	72-75	4	14
α-helix	82-92	11
β-strand	95-98	4	14
α-helix	101-103	3
β-strand	110-112	3	14
α-helix	118-127	10
β-strand	134-137	4	15
α-helix	144-156	13
β-strand	161-164	4	15
α-helix	171-183	13
β-strand	188-192	5	15
α-helix	195-207	13
β-strand	216-222	7	15
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	15
α-helix	250-259	10
α-helix	277-298	22
α-helix	318-320	3
α-helix	323-330	8
β-strand	335-337	3	16
β-strand	340-342	3	16
β-strand	343-344	2	17
β-strand	349	1	14
β-strand	350-351	2	17
β-strand	355-360	6	15
β-strand	365-371	7	15
β-strand	378-379	2	15
β-strand	398-401	4	18
β-strand	409-410	2	19
α-helix	414-416	3
α-helix	419-422	4
β-strand	423-424	2	19
α-helix	426-437	12
β-strand	443-446	4	18
β-strand	455	1	20
β-strand	462	1	20
α-helix	464-470	7
β-strand	476-477	2	18
β-strand	482	1	21
α-helix	485-488	4
β-strand	491-493	3	18
β-strand	498-500	3	21
β-strand	502-507	6	22
α-helix	513-515	3
α-helix	518-520	3
β-strand	523	1	23
α-helix	525-547	23
α-helix	550-553	4
α-helix	577-588	12
α-helix	600-629	30
α-helix	640-645	6
β-strand	650-652	3	22
β-strand	654	1	24
α-helix	658-665	8
α-helix	669-679	11
β-strand	687	1	24
α-helix	690-699	10
β-strand	704-709	6	22
α-helix	710-717	8
β-strand	724-727	4	22
β-strand	734-736	3	21
β-strand	739-741	3	18
α-helix	747-759	13
α-helix	762-768	7
α-helix	769-773	5
β-strand	791	1	11
α-helix	793-795	3
α-helix	797-827	31

Chain C: 37 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	25
α-helix	18-31	14
β-strand	42-49	8	25
α-helix	55-68	14
β-strand	72-75	4	25
α-helix	82-91	10
β-strand	95-98	4	25
α-helix	101-103	3
β-strand	110-112	3	25
α-helix	115-116	2
α-helix	118-128	11
β-strand	132-137	6	26
α-helix	144-156	13
β-strand	159-164	6	26
α-helix	171-183	13
β-strand	188-192	5	26
α-helix	195-208	14
β-strand	216-219	4	26
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	26
α-helix	250-259	10
α-helix	277-298	22
α-helix	318-320	3
α-helix	321-330	10
β-strand	335-337	3	27
β-strand	340-342	3	27
β-strand	344	1	28
β-strand	350	1	28
β-strand	355-360	6	26
β-strand	365-372	8	26
β-strand	376-379	4	26
β-strand	398-401	4	29
β-strand	404	1	30
β-strand	408	1	30
β-strand	409-410	2	31
α-helix	419-422	4
β-strand	423-424	2	31
α-helix	426-437	12
β-strand	443-446	4	29
β-strand	455	1	32
β-strand	462	1	32
α-helix	464-470	7
β-strand	477-482	6	29
α-helix	485-488	4
β-strand	491-493	3	29
β-strand	498-500	3	29
β-strand	502-507	6	33
α-helix	513-515	3
α-helix	518-520	3
β-strand	523	1	34
α-helix	525-547	23
α-helix	550-553	4
α-helix	577-589	13
α-helix	600-633	34
α-helix	640-645	6
β-strand	650-652	3	33
β-strand	654	1	35
α-helix	658-665	8
α-helix	669-680	12
β-strand	687	1	35
α-helix	690-699	10
β-strand	704-709	6	33
α-helix	710-716	7
β-strand	724-727	4	33
β-strand	734-741	8	29
α-helix	747-759	13
α-helix	762-768	7
α-helix	769-773	5
α-helix	790	1
β-strand	791	1	23
α-helix	792	1
α-helix	793-795	3
α-helix	797-827	31

Chain D: 35 helices, 40 β-strands

Element	Residues	Length	Sheet
β-strand	5-12	8	36
α-helix	17-31	15
β-strand	42-49	8	36
α-helix	55-68	14
β-strand	72-75	4	36
α-helix	82-92	11
β-strand	95-98	4	36
α-helix	101-103	3
β-strand	111-112	2	36
α-helix	118-127	10
β-strand	134-137	4	37
α-helix	144-156	13
β-strand	161-164	4	37
α-helix	171-183	13
β-strand	188-192	5	37
α-helix	195-207	13
β-strand	216-219	4	37
α-helix	224-226	3
α-helix	230-235	6
β-strand	238-243	6	37
α-helix	250-259	10
α-helix	274-276	3
α-helix	277-298	22
α-helix	318-320	3
α-helix	323-330	8
β-strand	335-337	3	38
β-strand	340-342	3	38
β-strand	343-344	2	39
β-strand	349	1	36
β-strand	350-351	2	39
β-strand	355-360	6	37
β-strand	365-371	7	37
β-strand	378-379	2	37
β-strand	398-401	4	40
β-strand	404	1	41
β-strand	408	1	41
β-strand	409-410	2	42
α-helix	419-422	4
β-strand	423-424	2	42
α-helix	426-438	13
β-strand	443-446	4	40
β-strand	455	1	43
β-strand	462	1	43
α-helix	464-470	7
β-strand	476-477	2	40
β-strand	482	1	44
α-helix	485-488	4
β-strand	491-493	3	40
β-strand	498-500	3	44
β-strand	502-507	6	45
α-helix	513-515	3
α-helix	518-520	3
β-strand	523	1	13
α-helix	525-547	23
α-helix	550-553	4
α-helix	577-588	12
α-helix	600-629	30
α-helix	640-645	6
β-strand	650-652	3	45
β-strand	654	1	46
α-helix	658-665	8
α-helix	669-680	12
β-strand	687	1	46
α-helix	690-699	10
β-strand	704-709	6	45
α-helix	710-717	8
β-strand	724-727	4	45
β-strand	734-736	3	44
β-strand	739-741	3	40
α-helix	747-759	13
α-helix	762-768	7
α-helix	769-773	5
β-strand	791	1	34
α-helix	793-795	3
α-helix	797-827	31

Chain W: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-38	5	47
β-strand	57-61	5	47
β-strand	65-68	4	47
β-strand	77-79	3	47
α-helix	95-104	10
α-helix	106-125	20
α-helix	133-160	28
β-strand	175-176	2	47
α-helix	178-209	32

Chain X: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-38	5	48
β-strand	57-61	5	48
β-strand	65-68	4	48
β-strand	77-79	3	48
α-helix	95-104	10
α-helix	106-127	22
α-helix	133-160	28
β-strand	175-176	2	48
α-helix	178-209	32

Chain Y: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-25	19
β-strand	34-38	5	49
β-strand	57-61	5	49
β-strand	65-68	4	49
β-strand	77-79	3	49
α-helix	96-104	9
α-helix	106-127	22
α-helix	133-160	28
β-strand	175-176	2	49
α-helix	178-209	32

Chain Z: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	7-29	23
β-strand	34-38	5	50
β-strand	57-61	5	50
β-strand	65-68	4	50
β-strand	77-79	3	50
α-helix	94-104	11
α-helix	106-127	22
α-helix	133-160	28
β-strand	175-176	2	50
α-helix	178-209	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Isoform Flip of Glutamate receptor 3,Voltage-dependent calcium channel gamma-2 subunit	A, B, C, D, W, X, Y, Z	protein	1170	Rattus norvegicus	P19492 (AlphaFold model), Q71RJ2 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, W, X, Y, Z), FASTA

>9QFH_1 Isoform Flip of Glutamate receptor 3,Voltage-dependent calcium channel gamma-2 subunit (chains A, B, C, D, W, X, Y, Z)
FPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFHLNYHVDHLDSSNSFSVTNA
FCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQMRPALKGAI
LSLLSYYKWEKFVYLYDTERGFSVLQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEM
DRRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITG
FQIVNNENPMVQQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRV
DVSRRGSAGDCLANPAVPWSQGIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMK
VSGSRKAGYWNEYERFVPFSDQQISNDSSSSENRTIVVTTILESPYVMYKKNHEQLEGNE
RYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPL
TITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV
LFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLS
GRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKE
FFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKP
CDTMKVGGNLDSKGYGVATPKGSALGTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKD
SGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYKSRAESKRMKLTKNTQNFKPA
PAGGSGSGGLFDRGVQMLLTTVGAFAAFSLMTIAVGTDYWLYSRGVCKTKSVSENETSKK
NEEVMTHSGLWRTCCLEGNFKGLCKQIDHFPEDADYEADTAEYFLRAVRASSIFPILSVI
LLFMGGLCIAASEFYKTRHNIILSAGIFFVSAGLSNIIGIIVYISANAGDPSKSDSKKNS
YSYGWSFYFGALSFIIAEMVGVLAVHMFIDRHKQLRATARATDYLQASAITRIPSYRYRY
QRRSRSSSRSTEPSHSRDASPVGVKGFNTLPSTEISMYTLSRDPLKAATTPTATYNSDRD
NSFLQVHNCIQKDSKDSLHANTANRRTTPV

Primary citation

Architecture, dynamics and biogenesis of GluA3 AMPA glutamate receptors. Pokharna, A., Stockwell, I., Ivica, J. et al. Nature (2025) 645:535-543. DOI 10.1038/s41586-025-09325-z · PubMed

Other PDB entries of the same protein (UniProt P19492 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4F29 1.75 Å, Quisqualate bound to the ligand binding domain of GluA3i
3LSW 1.75 Å, Aniracetam bound to the ligand binding domain of GluA3
4F1Y 1.79 Å, CNQX bound to the ligand binding domain of GluA3
3M3K 1.79 Å, Ligand binding domain (S1S2) of GluA3 (flop)
4F3B 1.82 Å, Glutamate bound to the D655A mutant of the ligand binding domain of GluA3
4F39 1.83 Å, Kainate bound to the ligand binding domain of GluA3
3DLN 1.91 Å, Crystal structure of the binding domain of the AMPA subunit GluR3 bound to glutamate
4F2O 1.91 Å, Quisqualate bound to the D655A mutant of the ligand binding domain of GluA3
6FPJ 1.96 Å, Structure of the AMPAR GluA3 N-terminal domain bound to phosphate
3LSX 2.01 Å, Piracetam bound to the ligand binding domain of GluA3
4F22 2.06 Å, Kainate bound to the K660A mutant of the ligand binding domain of GluA3
4F3G 2.06 Å, Kainate bound to the ligand binding domain of GluA3i

Browse structure collections

About this viewer

MolViewer shows 9QFH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.