Structure of lysozyme by continuous serial electron diffraction (SerialED). Determined by electron crystallography at 0.83 Å resolution. Released 22 Apr 2026.
Explore 9QUM in 3D Show helices and sheets RCSB PDB PDBe
9QUM contains 7 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2 | 1 | 1 |
| α-helix | 5-14 | 10 | |
| β-strand | 20 | 1 | 2 |
| β-strand | 23 | 1 | 2 |
| α-helix | 25-36 | 12 | |
| β-strand | 39 | 1 | 1 |
| β-strand | 43-45 | 3 | 3 |
| β-strand | 51-53 | 3 | 3 |
| β-strand | 58-59 | 2 | 3 |
| β-strand | 65 | 1 | 4 |
| β-strand | 79 | 1 | 4 |
| α-helix | 80-84 | 5 | |
| α-helix | 89-100 | 12 | |
| α-helix | 105-107 | 3 | |
| α-helix | 109-114 | 6 | |
| α-helix | 120-124 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Lysozyme C | A | protein | 147 | Gallus gallus | P00698 (AlphaFold model) |
>9QUM_1 Lysozyme C (chains A) MRSLLILVLCFLPLAALGKVFGRCELAAAMKRHGLDNYRGYSLGNWVCAAKFESNFNTQA TNRNTDGSTDYGILQINSRWWCNDGRTPGSRNLCNIPCSALLSSDITASVNCAKKIVSDG NGMNAWVAWRNRCKGTDVQAWIRGCRL
Continuous Serial Electron Diffraction for High Quality Protein Structures. Hofer, G., Wang, L., Pacoste, L. et al. To be published.
Other PDB entries of the same protein (UniProt P00698 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9QUM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.