9R1P: STUB1

Crystal structure of STUB1 complexed with a compound molecule. Determined by X-ray diffraction at 2.29 Å resolution. Released 17 Sept 2025.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,024
Mol. weight: 16.33 kDa
Ligands: A1JBJ
Released: 17 Sept 2025

Explore 9R1P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9R1P contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-131	22
α-helix	133-136	4
α-helix	137-139	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CHIP	A	protein	140	Homo sapiens	Q9UNE7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9R1P_1 E3 ubiquitin-protein ligase CHIP (chains A)
GGGGGSPEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKM
QQHEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGD
DIPSALRIAKKKRWNSIEER

Ligands and cofactors

ID	Name	Formula	Copies
A1JBJ	1-[3-[1-methyl-4-(pyridin-3-ylmethylamino)pyrazolo[3,4-d]pyrimidin-6-yl]phenyl]…	C26 H21 F3 N8 S	1

Primary citation

A rapid imaging-based screen for induced-proximity degraders identifies a potent degrader of oncoprotein SKP2. Chu, Y., Chen, S., Yang, M. et al. Nat Biotechnol (2026) 44:1142-1153. DOI 10.1038/s41587-025-02793-8 · PubMed

Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QFY 1.06 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9.
6NSV 1.3 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated…
9QFS 1.33 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8.
9QEU 1.35 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
8EI0 1.47 Å, Crystal structure of the STUB1 TPR domain in complex with H318, a Helicon Polypeptide
6EFK 1.5 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated HSP70…
9QF1 1.51 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2
8F16 1.56 Å, Structure of the STUB1 TPR domain in complex with H203, an all-D Helicon Polypeptide
9DYB 1.6 Å, CHIP-TPR in complex with the phosphorylated Hsp70 tail
8SUV 1.63 Å, CHIP-TPR in complex with the C-terminus of CHIC2
8F14 1.69 Å, Structure of the STUB1 TPR domain in complex with H201, an all-D Helicon Polypeptide

Browse structure collections

About this viewer

MolViewer shows 9R1P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.