9R9W: Capsid protein

RNA-free helical (h8.5) virus-like particle composed of TEV coat protein. Determined by electron microscopy at 3.34 Å resolution. Released 21 Jan 2026.

Method: Electron microscopy
Resolution: 3.34 Å
Organism: Tobacco etch virus
Chains: 24
Atoms: 37,968
Mol. weight: 712.38 kDa
Released: 21 Jan 2026

Explore 9R9W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9R9W contains 312 α-helices and 96 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains Aa, Ab, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Aq, Ar, As, At, Au, Av, Aw and Ax: 13 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	40-45	6
β-strand	55-56	2	1
β-strand	59-60	2	1
α-helix	64-68	5
α-helix	74-76	3
α-helix	84-98	15
α-helix	102-119	18
β-strand	128-133	6	2
β-strand	136-141	6	2
α-helix	143-147	5
α-helix	153-157	5
α-helix	158-160	3
α-helix	161-171	11
α-helix	180-183	4
α-helix	190-195	6
α-helix	208-223	16
α-helix	228-230	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Capsid protein	Aa, Ab, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Aq, Ar, As, At, Au, Av, Aw, Ax	protein	263	Tobacco etch virus	P04517

Sequence of entity 1 (Aa, Ab, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Aq, Ar, As, At, Au, Av, Aw, Ax), FASTA

>9R9W_1 Capsid protein (chains Aa, Ab, Ac, Ad, Ae, Af, Ag, Ah, Ai, Aj, Ak, Al, Am, An, Ao, Ap, Aq, Ar, As, At, Au, Av, Aw, Ax)
SGTVDAGADAGKKKDQKDDKVAEQASKDRDVNAGTSGTFSVPRINAMATKLQYPRMRGEV
VVNLNHLLGYKPQQIDLSNARATHEQFAAWHQAVMTAYGVNEEQMKILLNGFMVWCIENG
TSPNLNGTWVMMDGEDQVSYPLKPMVENAQPTLRQIMTHFSDLAEAYIEMRNRERPYMPR
YGLQRNITDMSLSRYAFDFYELTSKTPVRAREAHMQMKAAAVRNSGTRLFGLDGNVGTAE
EDTERHTAHDVNRNMHTLLGVRQ

Primary citation

Species-specific structural adaptation of the potyviral coat protein in virions and virus-like particles. Koritnik, N., Kezar, A., Kavcic, L. et al. Commun Biol (2026) 9:226-226. DOI 10.1038/s42003-025-09502-w · PubMed

Other PDB entries of the same protein (UniProt P04517), best resolution first:

1LVM 1.8 Å, Catalytically active tobacco etch virus protease complexed with product
1LVB 2.2 Å, Catalytically inactive tobacco etch virus protease complexed with substrate
1Q31 2.7 Å, Crystal Structure of the Tobacco Etch Virus Protease C151A mutant
6SUQ 3.7 Å, Crystal Structure of TcdB2-TccC3-TEV

Browse structure collections

About this viewer

MolViewer shows 9R9W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.