X-ray structure of a polyoxidovanadate/human H-ferritin adduct obtained when the protein is treated 24 h with [VIVO(acac)2]. Determined by X-ray diffraction at 1.5 Å resolution. Released 3 Dec 2025.
Explore 9RGJ in 3D Show helices and sheets RCSB PDB PDBe
9RGJ contains 9 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-6 | 3 | |
| α-helix | 14-41 | 28 | |
| α-helix | 49-76 | 28 | |
| α-helix | 86-88 | 3 | |
| α-helix | 96-123 | 28 | |
| α-helix | 127-133 | 7 | |
| α-helix | 134-138 | 5 | |
| α-helix | 139-158 | 20 | |
| α-helix | 164-173 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ferritin heavy chain | AAA | protein | 182 | Homo sapiens | P02794 (AlphaFold model) |
>9RGJ_1 Ferritin heavy chain (chains AAA) TTASTSQVRQNYHQDSEAAINRQINLELYASYVYLSMSYYFDRDDVALKNFAKYFLHQSH EEREHAEKLMKLQNQRGGRIFLQDIKKPDCDDWESGLNAMECALHLEKNVNQSLLELHKL ATDKNDPHLCDFIETHYLNEQVKAIKELGDHVTNLRKMGAPESGLAEYLFDKHTLGDSDN ES
Water and common crystallization additives (CL) are not listed.
Spherical mixed-valence pentadecavanadate binding to human H-chain ferritin. Lucignano, R., Tito, G., Ferraro, G. et al. Inorg Chem Front (2025) 12:6870-6875. DOI 10.1039/D5QI01694K
Other PDB entries of the same protein (UniProt P02794 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9RGJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.