9RON: PDB entry 9RON

Human alpha1 Na+,K+-ATPase in the Na+-bound E1 state. Determined by electron microscopy at 3.41 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.41 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,272
Mol. weight: 159.51 kDa
Ligands: ATP
Released: 12 Aug 2026

Explore 9RON in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RON contains 67 α-helices and 47 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 54 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	33-36	4
α-helix	48-55	8
α-helix	65-75	11
α-helix	80-84	5
α-helix	90-94	5
α-helix	100-121	22
α-helix	128-163	36
β-strand	168-173	6	1
β-strand	176-181	6	1
α-helix	182-184	3
β-strand	190-194	5	1
β-strand	197-198	2	1
β-strand	202-214	13	1
β-strand	224-225	2	1
β-strand	242	1	1
β-strand	248-260	13	1
α-helix	262-264	3
α-helix	283-312	30
α-helix	317-331	15
α-helix	336-353	18
β-strand	356-357	2	2
α-helix	361-363	3
α-helix	364-368	5
β-strand	372-374	3	2
α-helix	377-381	5
β-strand	382	1	3
β-strand	387-393	7	4
β-strand	396-399	4	4
α-helix	416-428	13
β-strand	432-433	2	5
α-helix	434	1
β-strand	447-448	2	5
α-helix	451-463	13
α-helix	467-473	7
β-strand	475-479	5	4
β-strand	489-494	6	4
β-strand	504-509	6	4
α-helix	511-516	6
β-strand	518-523	6	4
β-strand	526-529	4	4
α-helix	532-547	16
β-strand	550-559	10	4
β-strand	583-592	10	4
α-helix	594	1
β-strand	595	1	3
α-helix	596	1
α-helix	599-608	10
β-strand	612-615	4	2
α-helix	621-630	10
α-helix	635	1
α-helix	641-648	8
α-helix	652-654	3
β-strand	663-666	4	2
α-helix	667-672	6
α-helix	675-684	10
β-strand	688-691	4	2
α-helix	695-707	13
β-strand	712-716	5	2
α-helix	719-721	3
α-helix	722-727	6
β-strand	730-733	4	2
α-helix	740-745	6
β-strand	749-750	2	2
α-helix	755-781	27
α-helix	784-786	3
α-helix	788-795	8
α-helix	804-813	10
α-helix	817-822	6
α-helix	825-827	3
α-helix	831-833	3
α-helix	847-850	4
α-helix	851-856	6
α-helix	857-876	20
α-helix	880-883	4
α-helix	887-890	4
β-strand	898-899	2	6
β-strand	905-906	2	6
α-helix	908-937	30
α-helix	944-947	4
α-helix	952-970	19
α-helix	974-977	4
α-helix	982-984	3
α-helix	985-989	5
α-helix	992-1011	20
α-helix	1016-1020	5

Chain B: 12 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	29-60	32
α-helix	70-72	3
α-helix	75	1
β-strand	76	1	7
β-strand	77-79	3	8
β-strand	87-89	3	9
α-helix	95-97	3
α-helix	99-109	11
α-helix	110-112	3
β-strand	123-124	2	10
α-helix	133-134	2
β-strand	148-149	2	10
α-helix	153-156	4
β-strand	175-180	6	8
α-helix	181-182	2
β-strand	184	1	11
α-helix	190-192	3
α-helix	205-207	3
β-strand	209-210	2	12
β-strand	212-214	3	9
β-strand	225-230	6	8
α-helix	232-234	3
β-strand	237-238	2	12
β-strand	245	1	11
β-strand	258-265	8	8
β-strand	272-277	6	9
β-strand	292	1	7
β-strand	294-300	7	9

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-56	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-1	A	protein	1023	Homo sapiens	P05023 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B	protein	319	Homo sapiens	P05026 (AlphaFold model)
Phospholemman	C	protein	76	Homo sapiens	O00168 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9RON_1 Sodium/potassium-transporting ATPase subunit alpha-1 (chains A)
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Sequence of entity 2 (B), FASTA

>9RON_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B)
MARSHHHHHHHHHHPRRSRGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYG
CLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLN
IVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLND
ETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKV
GNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIG
YSEKDRFQGRFDVKIEVKS

Sequence of entity 3 (C), FASTA

>9RON_3 Phospholemman (chains C)
GTKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEE
EGTFRSSIRRLSTRRR

Ligands and cofactors

ID	Name	Formula	Copies
ATP	Adenosine-5'-triphosphate	C10 H16 N5 O13 P3	1

Primary citation

Active conformations of neuronal Na + , K + -ATPase isoforms and a disease-causing mutant. Christensen, M.E., Habeck, M., Katz, A. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75997-4 · PubMed

Other PDB entries of the same protein (UniProt P05023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WAJ 2.39 Å, Cryo-EM structure of a human sodium pump wildtype in ouabain-bound E2P state
24RC 2.61 Å, Cryo-EM structure of human sodium pump W931R mutant in K+-occluded E2-Pi state
7E20 2.7 Å, Cryo EM structure of a K+-bound Na+,K+-ATPase in the E2 state
9WAK 2.86 Å, Cryo-EM structure of a human sodium pump W931R mutant in ouabain-bound E2P state
7E21 2.9 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state with ATP-gamma-S
9KCI 2.9 Å, Cryo-EM structure of human sodium pump WT in (2K+)E2-AlF state
9KCK 2.9 Å, Cryo-EM structure of human sodium pump E1003K in (2K+)E2-AlF state
9KCL 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1-AMPPCP…
9KCM 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 and TMX2 in…
9KCG 3.1 Å, Cryo-EM structure of human sodium pump WT in (3Na+)E1-AMPPCP state
9KCJ 3.1 Å, Cryo-EM structure of human sodium pump E1003 in (3Na+)E1-AMPPCP state
7E1Z 3.2 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state

Browse structure collections

About this viewer

MolViewer shows 9RON directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.