9ROP: PDB entry 9ROP

Human alpha1 Na+,K+-ATPase in the Na+-occluded E2P state. Determined by electron microscopy at 3.24 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.24 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,269
Mol. weight: 159 kDa
Released: 12 Aug 2026

Explore 9ROP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ROP contains 68 α-helices and 48 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 54 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	31-37	7
α-helix	39-40	2
α-helix	48-54	7
α-helix	62	1
β-strand	63	1	1
α-helix	64	1
α-helix	65-75	11
α-helix	80-84	5
α-helix	91-96	6
α-helix	100-121	22
α-helix	127-158	32
β-strand	168-173	6	1
β-strand	176-181	6	1
β-strand	190-193	4	2
β-strand	197-199	3	3
β-strand	202-209	8	2
β-strand	212-213	2	3
α-helix	224	1
β-strand	225-226	2	3
β-strand	242-243	2	2
β-strand	247-249	3	3
β-strand	253-260	8	2
α-helix	266-274	9
α-helix	283-312	30
α-helix	317-330	14
α-helix	336-353	18
β-strand	358	1	4
α-helix	362-368	7
β-strand	372-375	4	5
β-strand	387-393	7	6
β-strand	396-399	4	6
α-helix	416-428	13
α-helix	432-433	2
α-helix	442-444	3
α-helix	451-463	13
α-helix	467-472	6
β-strand	475-480	6	6
β-strand	489-495	7	6
β-strand	502-509	8	6
α-helix	511-516	6
β-strand	518-523	6	6
β-strand	526-529	4	6
α-helix	532-546	15
β-strand	551-560	10	6
α-helix	570-572	3
β-strand	583-592	10	6
α-helix	593-595	3
α-helix	598-608	11
β-strand	612-616	5	5
α-helix	621-631	11
α-helix	641-648	8
α-helix	652-654	3
α-helix	657-659	3
β-strand	663-666	4	5
α-helix	675-684	10
β-strand	688-691	4	5
α-helix	695-707	13
β-strand	712-714	3	5
α-helix	719-721	3
α-helix	722-727	6
β-strand	730-731	2	5
β-strand	732-734	3	4
α-helix	740-745	6
β-strand	748-750	3	4
α-helix	756-781	26
α-helix	783-795	13
α-helix	804-813	10
α-helix	817-823	7
α-helix	825-827	3
α-helix	831-833	3
α-helix	835-837	3
α-helix	847-850	4
α-helix	851-856	6
α-helix	858-875	18
α-helix	880-883	4
α-helix	887-890	4
β-strand	898-899	2	7
β-strand	905-906	2	7
α-helix	908-937	30
α-helix	944-947	4
α-helix	952-970	19
α-helix	974-978	5
α-helix	988-990	3
α-helix	992-1011	20
α-helix	1016-1021	6

Chain B: 13 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	29-60	32
α-helix	70-72	3
α-helix	75	1
β-strand	76	1	8
α-helix	77	1
β-strand	78-79	2	9
β-strand	87-88	2	10
α-helix	95-109	15
α-helix	110-112	3
α-helix	115-117	3
β-strand	123-124	2	11
β-strand	148-149	2	11
α-helix	153-156	4
β-strand	175-179	5	9
α-helix	180-182	3
β-strand	184	1	12
α-helix	190-192	3
α-helix	205-207	3
β-strand	208-210	3	13
β-strand	212-216	5	10
β-strand	219	1	10
β-strand	227-230	4	9
β-strand	237-239	3	13
α-helix	240-242	3
β-strand	245	1	12
α-helix	256-257	2
β-strand	258-263	6	9
β-strand	272-277	6	10
β-strand	292	1	8
β-strand	294-299	6	10

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	34-55	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-1	A	protein	1023	Homo sapiens	P05023 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B	protein	319	Homo sapiens	P05026 (AlphaFold model)
Phospholemman	C	protein	76	Homo sapiens	O00168 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ROP_1 Sodium/potassium-transporting ATPase subunit alpha-1 (chains A)
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Sequence of entity 2 (B), FASTA

>9ROP_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B)
MARSHHHHHHHHHHPRRSRGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYG
CLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLN
IVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLND
ETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKV
GNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIG
YSEKDRFQGRFDVKIEVKS

Sequence of entity 3 (C), FASTA

>9ROP_3 Phospholemman (chains C)
GTKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEE
EGTFRSSIRRLSTRRR

Primary citation

Active conformations of neuronal Na + , K + -ATPase isoforms and a disease-causing mutant. Christensen, M.E., Habeck, M., Katz, A. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75997-4 · PubMed

Other PDB entries of the same protein (UniProt P05023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WAJ 2.39 Å, Cryo-EM structure of a human sodium pump wildtype in ouabain-bound E2P state
24RC 2.61 Å, Cryo-EM structure of human sodium pump W931R mutant in K+-occluded E2-Pi state
7E20 2.7 Å, Cryo EM structure of a K+-bound Na+,K+-ATPase in the E2 state
9WAK 2.86 Å, Cryo-EM structure of a human sodium pump W931R mutant in ouabain-bound E2P state
7E21 2.9 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state with ATP-gamma-S
9KCI 2.9 Å, Cryo-EM structure of human sodium pump WT in (2K+)E2-AlF state
9KCK 2.9 Å, Cryo-EM structure of human sodium pump E1003K in (2K+)E2-AlF state
9KCL 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1-AMPPCP…
9KCM 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 and TMX2 in…
9KCG 3.1 Å, Cryo-EM structure of human sodium pump WT in (3Na+)E1-AMPPCP state
9KCJ 3.1 Å, Cryo-EM structure of human sodium pump E1003 in (3Na+)E1-AMPPCP state
7E1Z 3.2 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state

Browse structure collections

About this viewer

MolViewer shows 9ROP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.