9ROQ: PDB entry 9ROQ

Human alpha1 Na+,K+-ATPase in the outward open E2P state. Determined by electron microscopy at 3.33 Å resolution. Released 12 Aug 2026.

Method: Electron microscopy
Resolution: 3.33 Å
Organism: Homo sapiens
Chains: 3
Atoms: 10,305
Mol. weight: 159 kDa
Released: 12 Aug 2026

Explore 9ROQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9ROQ contains 67 α-helices and 46 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 58 helices, 32 β-strands

Element	Residues	Length	Sheet
α-helix	31-37	7
α-helix	39-40	2
α-helix	48-54	7
β-strand	58	1	1
β-strand	62-63	2	1
α-helix	65-75	11
α-helix	81	1
α-helix	83	1
α-helix	89-93	5
α-helix	94-97	4
α-helix	100-119	20
α-helix	129-159	31
β-strand	168-173	6	1
β-strand	176-181	6	1
α-helix	182-184	3
β-strand	190-194	5	1
α-helix	197	1
β-strand	198	1	1
α-helix	199	1
β-strand	202-214	13	1
β-strand	225-226	2	1
α-helix	236-238	3
β-strand	242-243	2	1
β-strand	248-260	13	1
α-helix	262-264	3
α-helix	266-275	10
α-helix	283-314	32
α-helix	317-331	15
α-helix	336-353	18
β-strand	357-358	2	2
β-strand	372-375	4	3
α-helix	377-381	5
β-strand	382	1	4
β-strand	388-393	6	5
β-strand	396-399	4	5
α-helix	416-428	13
α-helix	442-444	3
α-helix	451-464	14
α-helix	468-472	5
β-strand	478-480	3	5
β-strand	488-493	6	5
β-strand	503-509	7	5
α-helix	511-516	6
β-strand	518-523	6	5
β-strand	526-529	4	5
α-helix	532-547	16
β-strand	551-560	10	5
β-strand	583-591	9	5
α-helix	593-594	2
β-strand	595	1	4
α-helix	596	1
α-helix	598-608	11
β-strand	612-616	5	3
α-helix	621-631	11
α-helix	641-648	8
α-helix	652-654	3
α-helix	657-659	3
β-strand	662-666	5	3
α-helix	667-672	6
α-helix	675-683	9
β-strand	687-691	5	3
α-helix	695-707	13
β-strand	712-715	4	3
α-helix	719-721	3
α-helix	722-727	6
β-strand	731	1	3
β-strand	732-734	3	2
α-helix	740-745	6
β-strand	748-750	3	2
α-helix	757-795	39
α-helix	798-800	3
α-helix	804-809	6
α-helix	810-814	5
α-helix	816-821	6
α-helix	831-833	3
α-helix	835-838	4
α-helix	847-849	3
α-helix	850-857	8
α-helix	858-875	18
α-helix	880-882	3
α-helix	887-890	4
β-strand	899	1	6
β-strand	905	1	6
α-helix	908-937	30
α-helix	944-947	4
α-helix	952-970	19
α-helix	974-977	4
α-helix	985-988	4
α-helix	992-1011	20
α-helix	1016-1021	6

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	32-57	26
α-helix	70-72	3
β-strand	78-79	2	7
β-strand	87-89	3	8
α-helix	95-110	16
α-helix	114-116	3
β-strand	123-124	2	9
α-helix	146-147	2
β-strand	148-149	2	9
α-helix	153-156	4
β-strand	175-179	5	7
α-helix	180-182	3
β-strand	184	1	10
α-helix	190-192	3
β-strand	208-210	3	11
β-strand	211-214	4	8
β-strand	227-230	4	7
β-strand	237-239	3	11
β-strand	245	1	10
β-strand	259-263	5	7
β-strand	272-278	7	8
β-strand	294-300	7	8

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	33-55	23

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Sodium/potassium-transporting ATPase subunit alpha-1	A	protein	1023	Homo sapiens	P05023 (AlphaFold model)
Sodium/potassium-transporting ATPase subunit beta-1	B	protein	319	Homo sapiens	P05026 (AlphaFold model)
Phospholemman	C	protein	76	Homo sapiens	O00168 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9ROQ_1 Sodium/potassium-transporting ATPase subunit alpha-1 (chains A)
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLS
RGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAA
TEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSI
NAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETR
NIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAV
FLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKN
LEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLA
LSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEI
PFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQN
AYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVP
DAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDA
KACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVN
DSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTL
TSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPK
TDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVED
SYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFE
ETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKE
TYY

Sequence of entity 2 (B), FASTA

>9ROQ_2 Sodium/potassium-transporting ATPase subunit beta-1 (chains B)
MARSHHHHHHHHHHPRRSRGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYG
CLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLN
IVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLND
ETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKV
GNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIG
YSEKDRFQGRFDVKIEVKS

Sequence of entity 3 (C), FASTA

>9ROQ_3 Phospholemman (chains C)
GTKAESPKEHDPFTYDYQSLQIGGLVIAGILFILGILIVLSRRCRCKFNQQQRTGEPDEE
EGTFRSSIRRLSTRRR

Primary citation

Active conformations of neuronal Na + , K + -ATPase isoforms and a disease-causing mutant. Christensen, M.E., Habeck, M., Katz, A. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-75997-4 · PubMed

Other PDB entries of the same protein (UniProt P05023 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9WAJ 2.39 Å, Cryo-EM structure of a human sodium pump wildtype in ouabain-bound E2P state
24RC 2.61 Å, Cryo-EM structure of human sodium pump W931R mutant in K+-occluded E2-Pi state
7E20 2.7 Å, Cryo EM structure of a K+-bound Na+,K+-ATPase in the E2 state
9WAK 2.86 Å, Cryo-EM structure of a human sodium pump W931R mutant in ouabain-bound E2P state
7E21 2.9 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state with ATP-gamma-S
9KCI 2.9 Å, Cryo-EM structure of human sodium pump WT in (2K+)E2-AlF state
9KCK 2.9 Å, Cryo-EM structure of human sodium pump E1003K in (2K+)E2-AlF state
9KCL 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 in (2Na+)E1-AMPPCP…
9KCM 2.9 Å, Cryo-EM structure of human sodium pump E1003K complexed with NDRG3 and TMX2 in…
9KCG 3.1 Å, Cryo-EM structure of human sodium pump WT in (3Na+)E1-AMPPCP state
9KCJ 3.1 Å, Cryo-EM structure of human sodium pump E1003 in (3Na+)E1-AMPPCP state
7E1Z 3.2 Å, Cryo EM structure of a Na+-bound Na+,K+-ATPase in the E1 state

Browse structure collections

About this viewer

MolViewer shows 9ROQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.