9RP9: Mouse pVHL-ElonginB-ElonginC complex

Crystal structure of mouse pVHL-ElonginB-ElonginC complex. Determined by X-ray diffraction at 2.1 Å resolution. Released 9 Jul 2025.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Mus musculus
Chains: 3
Atoms: 2,936
Mol. weight: 42.7 kDa
Released: 9 Jul 2025

Explore 9RP9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RP9 contains 17 α-helices and 27 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	37-44	8	1
α-helix	49	1
β-strand	50-55	6	2
β-strand	61-63	3	2
β-strand	67	1	2
β-strand	72-78	7	1
β-strand	82-87	6	2
β-strand	93	1	2
β-strand	95-96	2	1
β-strand	99	1	1
β-strand	102	1	2
α-helix	112	1
β-strand	113-118	6	1
α-helix	124-135	12
α-helix	138-143	6
α-helix	148-155	8
α-helix	160-173	14

Chain B: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-9	8	3
β-strand	10	1	4
β-strand	12-19	8	3
β-strand	23	1	5
α-helix	24-35	12
α-helix	39-41	3
β-strand	42-46	5	3
β-strand	49-50	2	3
α-helix	51-52	2
β-strand	56	1	5
α-helix	57-60	4
β-strand	68	1	6
β-strand	71	1	6
β-strand	73-79	7	3
β-strand	80-81	2	7
β-strand	84-85	2	7
α-helix	86-88	3
β-strand	90	1	4
α-helix	91-100	10
α-helix	101-103	3

Chain C: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	18-22	5	3
β-strand	28-32	5	3
α-helix	33-36	4
α-helix	40-46	7
β-strand	59-61	3	3
α-helix	67-83	17
α-helix	100-110	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
von Hippel-Lindau disease tumor suppressor	A	protein	164	Mus musculus	P40338 (AlphaFold model)
Elongin-B	B	protein	104	Mus musculus	P62869 (AlphaFold model)
Elongin-C	C	protein	97	Mus musculus	P83940 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9RP9_1 von Hippel-Lindau disease tumor suppressor (chains A)
GSMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPLWLNFDGEPQPYPILPPGTGRRIHS
YRGHLWLFRDAGTHDGLLVNQTELFVPSLNVDGQPIFANITLPVYTLKERCLQVVRSLVK
PENYRRLDIVRSLYEDLEDYPSVRKDIQRLSQEHLESQHLEEEP

Sequence of entity 2 (B), FASTA

>9RP9_2 Elongin-B (chains B)
MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC
GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMK

Sequence of entity 3 (C), FASTA

>9RP9_3 Elongin-C (chains C)
MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCM
YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC

Primary citation

Crystal structure of mouse pVHL-ElonginB-ElonginC complex. Blat, A., Biterova, E., Cukier, C. To be published.

Other PDB entries of the same protein (UniProt P40338 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1HV2 Solution structure of yeast elongin C in complex with a von hippel-lindau peptide

Browse structure collections

About this viewer

MolViewer shows 9RP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.