1HV2: Yeast elongin C

Solution structure of yeast elongin C in complex with a von hippel-lindau peptide. Determined by solution NMR. Released 6 Sept 2001.

Method: Solution NMR
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 918
Mol. weight: 13.11 kDa
Released: 6 Sept 2001

Explore 1HV2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1HV2 contains 6 α-helices and 5 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
β-strand	14-19	6	1
α-helix	20-23	4
α-helix	27-34	8
β-strand	43-46	4	1
β-strand	47	1	2
β-strand	49	1	2
α-helix	51-70	20
α-helix	77-79	3
α-helix	84-97	14

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	158-170	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Elongin C	A	protein	99	Saccharomyces cerevisiae	Q03071 (AlphaFold model)
Von hippel-lindau disease tumor suppressor	B	protein	15		P40338 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1HV2_1 ELONGIN C (chains A)
MSQDFVTLVSKDDKEYEISRSAAMISPTLKAMIEGPFRESKGRIELKQFDSHILEKAVEY
LNYNLKYSGVSEDDDEIPEFEIPTEMSLELLLAADYLSI

Sequence of entity 2 (B), FASTA

>1HV2_2 VON HIPPEL-LINDAU DISEASE TUMOR SUPPRESSOR (chains B)
TLKERCLQVVRSLVK

Primary citation

Solution structure and dynamics of yeast elongin C in complex with a von Hippel-Lindau peptide. Botuyan, M.V., Mer, G., Yi, G.S. et al. J Mol Biol (2001) 312:177-186. DOI 10.1006/jmbi.2001.4938 · PubMed

Other PDB entries of the same protein (UniProt Q03071 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5ZB2 2.3 Å, Crystal structure of Rad7 and Elc1 complex in yeast
6R7I 5.9 Å, Structural basis of Cullin-2 RING E3 ligase regulation by the COP9 signalosome
6R6H 8.4 Å, Structural basis of Cullin-2 RING E3 ligase regulation by the COP9 signalosome

Browse structure collections

About this viewer

MolViewer shows 1HV2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.