9RT2: NetF - ANTXR2 structure

Name: PDB 9RT2: NetF - ANTXR2 structure (C4)
Published: 2026-02-18
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

NetF - ANTXR2 structure (C4). Determined by electron microscopy at 2.6 Å resolution. Released 18 Feb 2026.

Method: Electron microscopy
Resolution: 2.6 Å
Organisms: Clostridium perfringens, Homo sapiens
Chains: 12
Atoms: 25,748
Mol. weight: 402.91 kDa
Released: 18 Feb 2026

Explore 9RT2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RT2 contains 90 α-helices and 242 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains C1, C2, C3 and C4: 11 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	2-4	3
β-strand	6	1	7
β-strand	11-17	7	8
α-helix	20-22	3
α-helix	26-39	14
β-strand	40	1	7
β-strand	46-52	7	8
β-strand	57-63	7	8
α-helix	66-77	12
α-helix	87-101	15
α-helix	103-105	3
β-strand	108-114	7	8
α-helix	122-136	15
β-strand	138-145	8	8
α-helix	150-156	7
α-helix	160-162	3
β-strand	163-166	4	8
α-helix	170-176	7
α-helix	177-184	8
β-strand	187-192	6	9
β-strand	195-196	2	10
β-strand	203-209	7	9
β-strand	222-227	6	11
β-strand	230-234	5	11
β-strand	238-239	2	9
β-strand	243-247	5	9
β-strand	259-262	4	11
β-strand	275-276	2	11
β-strand	278-279	2	10

Chain N1: 7 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	23-33	11	1
β-strand	36-46	11	1
β-strand	50	1	2
β-strand	53-62	10	1
β-strand	63	1	3
β-strand	68-71	4	4
β-strand	75-91	17	4
α-helix	93-95	3
β-strand	98-102	5	1
α-helix	106-109	4
β-strand	110-128	19	5
β-strand	133-151	19	5
β-strand	154-157	4	4
β-strand	164-170	7	4
β-strand	193	1	6
α-helix	201-203	3
β-strand	205	1	6
α-helix	206-207	2
α-helix	208-210	3
α-helix	213-216	4
β-strand	219	1	3
β-strand	223-229	7	1
β-strand	235-253	19	4
β-strand	258-263	6	4
α-helix	264-265	2
β-strand	269-278	10	4
β-strand	283-287	5	4

Chains N2, N4, N6 and N8: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	24-34	11	12
β-strand	37-47	11	12
β-strand	51	1	1
β-strand	53-63	11	12
β-strand	64-65	2	13
β-strand	69-72	4	14
β-strand	76-92	17	14
β-strand	99-104	6	12
α-helix	106-107	2
β-strand	111-129	19	5
β-strand	134-152	19	5
β-strand	154-161	8	14
β-strand	165-172	8	14
β-strand	189	1	14
β-strand	194	1	15
α-helix	202-204	3
β-strand	206	1	15
α-helix	207-208	2
α-helix	209-211	3
α-helix	214-217	4
β-strand	219-220	2	13
β-strand	224-231	8	12
β-strand	236-253	18	14
β-strand	260-264	5	14
α-helix	265-266	2
β-strand	270-279	10	14
β-strand	284-287	4	14

Chains N3, N5 and N7: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	24-34	11	16
β-strand	37-47	11	16
β-strand	51	1	12
β-strand	53-63	11	16
β-strand	64-65	2	17
β-strand	69-72	4	18
β-strand	76-92	17	18
β-strand	99-104	6	16
α-helix	106-107	2
β-strand	111-129	19	5
β-strand	134-152	19	5
β-strand	154-161	8	18
β-strand	165-172	8	18
β-strand	185	1	18
β-strand	189	1	18
β-strand	194	1	19
α-helix	202-204	3
β-strand	206	1	19
α-helix	207-208	2
α-helix	209-211	3
α-helix	214-217	4
β-strand	219-220	2	17
β-strand	224-231	8	16
β-strand	236-253	18	18
β-strand	260-264	5	18
β-strand	270-279	10	18
β-strand	284-287	4	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leukocidin/Hemolysin toxin family	N1, N2, N3, N4, N5, N6, N7, N8	protein	289	Clostridium perfringens	A0A0D3QGV4 (AlphaFold model)
Anthrax toxin receptor 2	C1, C2, C3, C4	protein	321	Homo sapiens	P58335 (AlphaFold model)

Sequence of entity 1 (N1, N2, N3, N4, N5, N6, N7, N8), FASTA

>9RT2_1 Leukocidin/Hemolysin toxin family (chains N1, N2, N3, N4, N5, N6, N7, N8)
MVHHHHHHNSFPESIINSKGKQAEVYTSSDASERDGIKTSLSASFIEDPNSNNLTALVSL
KGFIPSGLIKTGTYYSANMYWPSKYNINIETTDEKNNVKILESIPSNTIETVRVTESMGY
SIGGNVSVSKKSSSVGANAGFNVQRSVQYEQPDFKTIQKSDGIRKASWNIVFNKTKDGYD
QNSYHALYGNQLFMKSRLHNTGAKNLVEDKDLSPLISGGFTPNMVIALKAPKGTKKSMIN
LNYNLYQDLYTLEWYKTQWWGENRVAKEPYYTYQTYELDWENHTVEFIY

Sequence of entity 2 (C1, C2, C3, C4), FASTA

>9RT2_2 Anthrax toxin receptor 2 (chains C1, C2, C3, C4)
QEQPSCRRAFDLYFVLDKSGSVANNWIEIYNFVQQLAERFVSPEMRLSFIVFSSQATIIL
PLTGDRGKISKGLEDLKRVSPVGETYIHEGLKLANEQIQKAGGLKTSSIIIALTDGKLDG
LVPSYAEKEAKISRSLGASVYCVGVLDFEQAQLERIADSKEQVFPVKGGFQALKGIINSI
LAQSCTEILELQPSSVCVGEEFQIVLSGRGFMLGSRNGSVLCTYTVNETYTTSVKPVSVQ
LNSMLCPAPILNKAGETLDVSVSFNGGKSVISGSLIVTATECSNGRTENLYFQGGAGARS
IEGRIVKDYKDDDDKHHHHHH

Primary citation

Identification and structural characterization of anthrax toxin receptor 2 as the Clostridium perfringens NetF receptor. Wang, C., Cattalani, F., Iacovache, I. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-69526-6 · PubMed

Other PDB entries of the same protein (UniProt A0A0D3QGV4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9RSU 2.1 Å, NetF pore structure
9RSM 2.13 Å, NetF 9mer pre-pore structure on 2N2 nanodiscs.
9RT4 2.6 Å, NetF - ANTXR2 local refinement focused

Browse structure collections

About this viewer

MolViewer shows 9RT2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.