9RTB: Serotransferrin

Crystal structure of the adduct formed upon reaction of [V(IV)O(acetylacetonate)2] with human serum transferrin with Fe(III) bound at the C-lobe only. Determined by X-ray diffraction at 1.93 Å resolution. Released 15 Jul 2026.

Method: X-ray diffraction
Resolution: 1.93 Å
Organism: Homo sapiens
Chains: 1
Atoms: 5,785
Mol. weight: 76.16 kDa
Ligands: FE, MLI, A1JJT, BCT
Released: 15 Jul 2026

Explore 9RTB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9RTB contains 39 α-helices and 32 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 39 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	5-10	6	1
α-helix	13-27	15
β-strand	36-41	6	1
α-helix	45-53	9
β-strand	59	1	1
β-strand	60-62	3	2
α-helix	64-71	8
β-strand	77-84	8	2
β-strand	86	1	3
β-strand	91	1	3
β-strand	94-102	9	4
α-helix	109-111	3
β-strand	116-119	4	4
α-helix	125-129	5
α-helix	130-134	5
α-helix	136-138	3
α-helix	140	1
α-helix	142	1
α-helix	146-151	6
β-strand	156-158	3	4
α-helix	168-171	4
α-helix	187-196	10
β-strand	202-206	5	4
α-helix	209-213	5
α-helix	217-220	4
β-strand	223-226	4	4
β-strand	232-234	3	4
α-helix	235-240	6
β-strand	244-247	4	4
β-strand	250-254	5	2
α-helix	260-274	15
β-strand	301-304	4	2
α-helix	305-306	2
α-helix	311-315	5
α-helix	317-328	12
β-strand	342-346	5	5
α-helix	349-362	14
β-strand	366-370	5	5
α-helix	374-383	10
β-strand	388	1	5
β-strand	389-391	3	6
α-helix	393-401	9
β-strand	405-411	7	6
β-strand	427-433	7	7
β-strand	440	1	8
β-strand	443	1	8
β-strand	448-451	4	7
α-helix	457-461	5
α-helix	462-471	10
α-helix	476-478	3
β-strand	482-484	3	7
α-helix	493-495	3
α-helix	502-504	3
α-helix	516-526	11
β-strand	530-534	5	7
α-helix	537-540	4
α-helix	549-552	4
α-helix	556-558	3
β-strand	559-562	4	7
α-helix	563	1
β-strand	568-570	3	7
α-helix	574-576	3
β-strand	580-581	2	7
α-helix	582-585	4
β-strand	586-589	4	6
α-helix	591-593	3
α-helix	594-606	13
β-strand	637-639	3	6
α-helix	640	1
α-helix	647-663	17
α-helix	669-677	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Serotransferrin	AAA	protein	679	Homo sapiens	P02787 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>9RTB_1 Serotransferrin (chains AAA)
VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAV
TLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHT
GLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCS
TLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKD
CHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAH
GFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSV
NSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCED
TPEAGYFAVAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMGLLYNKINHCRFDEFF
SEGCAPGSKKDSSLCKLCMGSGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQ
NTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKI
LRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVG
NLRKCSTSSLLEACTFRRP

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	1
MLI	Malonate ion	C3 H2 O4	1
A1JJT	bis(oxidanyl)-oxidanylidene-(oxidanyl(oxidanylidene)vanadio)oxy-vanadium	H3 O6 V2	1
BCT	Bicarbonate ion	C H O3	7

Water and common crystallization additives (GOL) are not listed.

Primary citation

First crystal structure of an adduct formed upon reaction of a vanadium compound with human serum transferrin. Banneville, A.S., Lucignano, R., Paolillo, M. et al. To be published.

Other PDB entries of the same protein (UniProt P02787 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1RYO 1.2 Å, Human serum transferrin, N-lobe bound with oxalate
1A8E 1.6 Å, Human serum transferrin, recombinant N-terminal lobe
3SKP 1.7 Å, The structure of apo-human transferrin C-lobe with bound sulfate ions
1A8F 1.8 Å, Human serum transferrin, recombinant N-terminal lobe
1D3K 1.8 Å, Human serum transferrin
1FQE 1.8 Å, Crystal structures of mutant (K206A) that abolish the dilysine interaction in the N-lobe…
3FGS 1.8 Å, Crystal structure of G65R/K206E double mutant of the N-lobe human transferrin
1JQF 1.85 Å, Human Transferrin N-Lobe Mutant H249Q
1OQG 1.9 Å, Crystal structure of the D63E mutant of the N-lobe human transferrin
1D4N 2.0 Å, Human serum transferrin
1N84 2.05 Å, Human serum transferrin, N-lobe
1FQF 2.1 Å, Crystal structures of mutant (K296A) that abolish the dilysine interaction in the N-lobe…

Browse structure collections

About this viewer

MolViewer shows 9RTB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.