Crystal structure of human SIRT2 in complex with the covalent adduct of SirReal-triazole inhibitor Mz242 and ADP-ribose. Determined by X-ray diffraction at 1.1 Å resolution. Released 12 Nov 2025.
Explore 9S1Z in 3D Show helices and sheets RCSB PDB PDBe
9S1Z contains 19 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 64-71 | 8 | |
| β-strand | 79-83 | 5 | 1 |
| α-helix | 85-87 | 3 | |
| α-helix | 89-91 | 3 | |
| α-helix | 99-100 | 2 | |
| α-helix | 101-106 | 6 | |
| α-helix | 108-110 | 3 | |
| α-helix | 115-119 | 5 | |
| β-strand | 120 | 1 | 2 |
| α-helix | 121-126 | 6 | |
| α-helix | 129-138 | 10 | |
| α-helix | 147-157 | 11 | |
| β-strand | 161-166 | 6 | 1 |
| α-helix | 172-175 | 4 | |
| α-helix | 180-182 | 3 | |
| β-strand | 183-185 | 3 | 1 |
| β-strand | 188-195 | 8 | 3 |
| β-strand | 203-205 | 3 | 3 |
| α-helix | 206-214 | 9 | |
| α-helix | 217-219 | 3 | |
| β-strand | 220 | 1 | 4 |
| β-strand | 227 | 1 | 4 |
| β-strand | 228-232 | 5 | 3 |
| β-strand | 235 | 1 | 2 |
| α-helix | 238-240 | 3 | |
| α-helix | 241-250 | 10 | |
| β-strand | 256-260 | 5 | 1 |
| α-helix | 269-275 | 7 | |
| β-strand | 282-286 | 5 | 1 |
| β-strand | 292 | 1 | 5 |
| β-strand | 307 | 1 | 5 |
| β-strand | 317-321 | 5 | 1 |
| α-helix | 324-335 | 12 | |
| α-helix | 338-353 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| NAD-dependent protein deacetylase sirtuin-2 | A | protein | 304 | Homo sapiens | Q8IXJ6 (AlphaFold model) |
>9S1Z_1 NAD-dependent protein deacetylase sirtuin-2 (chains A) GHMERLLDELTLEGVARYMQSERCRRVICLVGAGISTSAGIPDFRSPSTGLYDNLEKYHL PYPEAIFEISYFKKHPEPFFALAKELYPGQFKPTICHYFMRLLKDKGLLLRCYTQNIDTL ERIAGLEQEDLVEAHGTFYTSHCVSASCRHEYPLSWMKEKIFSEVTPKCEDCQSLVKPDI VFFGESLPARFFSCMQSDFLKVDLLLVMGTSLQVQPFASLISKAPLSTPRLLINKEKAGQ SDPFLGMIMGLGGGMDFDSKKAYRDVAWLGECDQGCLALAELLGWKKELEDLVRREHASI DAQS
| ID | Name | Formula | Copies |
|---|---|---|---|
| BU3 | (r,r)-2,3-butanediol | C4 H10 O2 | 1 |
| ZN | Zinc ion | Zn | 1 |
| A1JK7 | [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]… | C39 H49 N12 O16 P2 S2 | 1 |
From Pharmacophore to Warhead: NAD + -Targeting Triazoles as Mechanism-Based Sirtuin Inhibitors. Friedrich, F., Meleshin, M., Papenkordt, N. et al. Angew Chem Int Ed Engl (2025) 64:e16782-e16782. DOI 10.1002/anie.202516782 · PubMed
Other PDB entries of the same protein (UniProt Q8IXJ6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9S1Z directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.