Ternary structure of 14-3-3, CRAF R256S NS mutant phosphopeptide (pS259), and compound 78 (1124378). Determined by X-ray diffraction at 1.67 Å resolution. Released 22 Apr 2026.
Explore 9S2I in 3D Show helices and sheets RCSB PDB PDBe
9S2I contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-15 | 13 | |
| α-helix | 19-31 | 13 | |
| α-helix | 34-37 | 4 | |
| α-helix | 38-69 | 32 | |
| α-helix | 74-76 | 3 | |
| α-helix | 80-102 | 23 | |
| α-helix | 103-107 | 5 | |
| α-helix | 108-110 | 3 | |
| α-helix | 114-134 | 21 | |
| α-helix | 140-161 | 22 | |
| α-helix | 167-178 | 12 | |
| α-helix | 179-183 | 5 | |
| α-helix | 187-202 | 16 | |
| α-helix | 205-207 | 3 | |
| α-helix | 210-230 | 21 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14-3-3 protein sigma | A | protein | 236 | Homo sapiens | P31947 (AlphaFold model) |
| RAF proto-oncogene serine/threonine-protein kinase | P | protein | 11 | Homo sapiens | P04049 (AlphaFold model) |
>9S2I_1 14-3-3 protein sigma (chains A) GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQ RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT
>9S2I_2 RAF proto-oncogene serine/threonine-protein kinase (chains P) QSSTSTPNVHM
| ID | Name | Formula | Copies |
|---|---|---|---|
| WQN | 1-[8-(4-bromophenyl)sulfonyl-5-oxa-2,8-diazaspiro[3.5]nonan-2-yl]-2-chloranyl-e… | C14 H16 Br Cl N2 O4 S | 1 |
| MG | Magnesium ion | Mg | 2 |
Water and common crystallization additives (CL) are not listed.
Restoring the 14-3-3/CRAF regulatory interaction in Noonan syndrome using molecular glues. Virta, J.M., Vickery, H.R., Konstantinidou, M. et al. Proc Natl Acad Sci U S A (2026) 123:e2602101123-e2602101123. DOI 10.1073/pnas.2602101123 · PubMed
Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9S2I directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.