9S72: Human CCT in Closed Conformation

Human CCT in Closed Conformation. Determined by electron microscopy at 2.71 Å resolution. Released 16 Sept 2026.

Method: Electron microscopy
Resolution: 2.71 Å
Organism: Homo sapiens
Chains: 16
Atoms: 64,888
Mol. weight: 955.74 kDa
Ligands: ADP, MG, AF3
Released: 16 Sept 2026

Explore 9S72 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9S72 contains 391 α-helices and 389 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain a: 24 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	9-12	4	63
α-helix	14-32	19
β-strand	43-47	5	64
β-strand	52-55	4	64
α-helix	58-64	7
α-helix	70-85	16
α-helix	92-109	18
α-helix	114-135	22
β-strand	138-139	2	65
α-helix	146-156	11
α-helix	165-178	14
β-strand	181-183	3	66
β-strand	187-189	3	66
α-helix	192-194	3
β-strand	196-201	6	67
β-strand	209-212	4	67
β-strand	213-216	4	68
β-strand	228-237	10	68
β-strand	241	1	69
α-helix	245-247	3
β-strand	250-254	5	19
α-helix	257-259	3
α-helix	260-280	21
β-strand	285-288	4	68
β-strand	292	1	69
α-helix	294-303	10
β-strand	306-308	3	68
α-helix	313-323	11
β-strand	328	1	68
β-strand	332	1	70
β-strand	338	1	70
α-helix	342-344	3
β-strand	346-355	10	68
β-strand	360-367	8	68
β-strand	373-379	7	67
α-helix	382-405	24
β-strand	407-410	4	65
α-helix	414-426	13
α-helix	427-429	3
α-helix	433-444	12
α-helix	447-455	9
α-helix	460-476	17
α-helix	481-485	5
β-strand	486-489	4	71
β-strand	494-497	4	71
α-helix	498-501	4
β-strand	504-506	3	65
α-helix	507-525	19
β-strand	527-533	7	63
α-helix	534-535	2

Chain A: 25 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	9-13	5	1
α-helix	15-32	18
α-helix	33-35	3
β-strand	42-46	5	2
β-strand	52-55	4	2
α-helix	58-64	7
α-helix	70-85	16
α-helix	92-109	18
α-helix	114-135	22
β-strand	138-139	2	3
α-helix	140-142	3
α-helix	146-156	11
α-helix	165-177	13
β-strand	181-182	2	4
β-strand	188-189	2	4
α-helix	192-194	3
β-strand	196-201	6	5
α-helix	205-207	3
β-strand	209-211	3	5
β-strand	213-216	4	6
β-strand	228-229	2	6
β-strand	232-237	6	6
β-strand	241	1	7
α-helix	245-247	3
β-strand	250-254	5	8
α-helix	257-259	3
α-helix	260-279	20
β-strand	285-288	4	6
β-strand	292	1	7
α-helix	297-302	6
β-strand	306-308	3	6
α-helix	313-323	11
β-strand	328	1	6
β-strand	332	1	9
β-strand	338	1	9
α-helix	342-344	3
β-strand	346-355	10	6
β-strand	360-367	8	6
β-strand	374-379	6	5
α-helix	382-405	24
β-strand	407-410	4	3
α-helix	414-427	14
α-helix	435-444	10
α-helix	447-454	8
α-helix	460-476	17
β-strand	486-489	4	10
β-strand	494-497	4	10
α-helix	498-501	4
β-strand	504-506	3	3
α-helix	507-525	19
β-strand	527-533	7	1
α-helix	534-535	2

Chain b: 24 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	12	1	11
α-helix	13	1
β-strand	17-19	3	12
α-helix	21-40	20
β-strand	49-53	5	13
β-strand	61-64	4	13
α-helix	67-73	7
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-143	21
β-strand	146-147	2	14
α-helix	152-166	15
α-helix	171-175	5
α-helix	176-188	13
α-helix	196-198	3
β-strand	199-205	7	15
α-helix	209-211	3
β-strand	213-214	2	15
β-strand	218-220	3	16
β-strand	224	1	17
α-helix	225	1
β-strand	232-233	2	16
β-strand	236-240	5	17
β-strand	244	1	18
β-strand	255-258	4	19
α-helix	261-282	22
β-strand	289-292	4	17
β-strand	296	1	18
α-helix	298-306	9
β-strand	310-312	3	17
α-helix	317-327	11
β-strand	331-332	2	17
α-helix	338-340	3
α-helix	342-343	2
β-strand	344-345	2	17
β-strand	348-354	7	16
β-strand	357-363	7	16
β-strand	371-377	7	15
α-helix	380-403	24
β-strand	405-408	4	14
α-helix	412-427	16
α-helix	432-453	22
α-helix	458-471	14
β-strand	476-479	4	20
β-strand	484-487	4	20
α-helix	488-491	4
β-strand	494-496	3	14
α-helix	497-515	19
β-strand	517-522	6	12
α-helix	523-525	3

Chain B: 21 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	17-20	4	72
α-helix	22-39	18
α-helix	40-42	3
β-strand	50-53	4	34
β-strand	61-64	4	34
α-helix	67-73	7
α-helix	79-94	16
α-helix	99-118	20
α-helix	123-143	21
β-strand	146-147	2	73
α-helix	152-166	15
α-helix	171-175	5
α-helix	176-188	13
β-strand	199-205	7	74
α-helix	209-211	3
β-strand	213-214	2	74
β-strand	218-220	3	75
β-strand	224	1	75
β-strand	232-240	9	75
β-strand	244	1	76
β-strand	252	1	77
β-strand	254	1	77
β-strand	255-258	4	8
α-helix	261-283	23
β-strand	289-292	4	75
β-strand	296	1	76
α-helix	298-306	9
β-strand	310-312	3	75
α-helix	317-327	11
β-strand	331-332	2	75
α-helix	342-343	2
β-strand	344-354	11	75
β-strand	357-365	9	75
β-strand	371-377	7	74
α-helix	380-402	23
β-strand	405-408	4	73
α-helix	412-425	14
α-helix	432-454	23
α-helix	458-470	13
β-strand	476-479	4	78
β-strand	484-487	4	78
α-helix	488-491	4
β-strand	494-496	3	73
α-helix	497-515	19
β-strand	517-522	6	72
α-helix	523-526	4

Chain c: 25 helices, 24 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	64
α-helix	20-36	17
α-helix	38-40	3
β-strand	47-51	5	79
β-strand	57-59	3	79
α-helix	63-67	5
α-helix	75-90	16
α-helix	95-113	19
α-helix	119-139	21
β-strand	142-143	2	80
α-helix	149-160	12
α-helix	164-168	5
α-helix	169-183	15
β-strand	184-187	4	81
β-strand	190-193	4	81
α-helix	195-198	4
β-strand	199-203	5	82
α-helix	209-211	3
β-strand	213-215	3	82
β-strand	218-220	3	83
β-strand	232-233	2	83
β-strand	238-241	4	84
β-strand	254-258	5	19
α-helix	263-283	21
β-strand	289-292	4	84
α-helix	298-306	9
β-strand	310-312	3	84
α-helix	317-327	11
β-strand	331-332	2	84
α-helix	335-337	3
α-helix	340-342	3
β-strand	344	1	84
β-strand	349-355	7	83
β-strand	358-364	7	83
β-strand	372-376	5	82
α-helix	381-403	23
β-strand	406-409	4	80
α-helix	413-425	13
α-helix	426-428	3
α-helix	434-442	9
α-helix	443-445	3
α-helix	446-453	8
α-helix	459-470	12
β-strand	478-480	3	85
β-strand	487-489	3	85
α-helix	490-493	4
β-strand	496-498	3	80
α-helix	499-518	20
β-strand	521-526	6	64

Chain C: 26 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	15-18	4	2
α-helix	20-36	17
α-helix	38-40	3
α-helix	45-46	2
β-strand	47-51	5	21
β-strand	57-60	4	21
α-helix	63-67	5
α-helix	75-90	16
α-helix	95-113	19
α-helix	119-139	21
β-strand	142-143	2	22
α-helix	149-160	12
α-helix	166-168	3
α-helix	169-183	15
β-strand	184-187	4	23
β-strand	190-193	4	23
β-strand	199-205	7	24
α-helix	209-211	3
β-strand	213-215	3	24
β-strand	218-220	3	25
β-strand	232-234	3	25
β-strand	238	1	26
β-strand	239-240	2	27
β-strand	241	1	28
β-strand	254-258	5	8
α-helix	263-283	21
β-strand	289-291	3	27
α-helix	298-305	8
β-strand	310-312	3	27
α-helix	317-323	7
α-helix	324-328	5
β-strand	332	1	28
α-helix	335-337	3
α-helix	340-342	3
β-strand	344	1	26
β-strand	349-355	7	25
β-strand	358-364	7	25
β-strand	372-378	7	24
α-helix	381-403	23
β-strand	406-409	4	22
α-helix	413-425	13
α-helix	426-428	3
α-helix	434-442	9
α-helix	443-445	3
α-helix	446-453	8
α-helix	459-469	11
β-strand	478-480	3	29
β-strand	487-489	3	29
α-helix	490-493	4
β-strand	496-498	3	22
α-helix	499-516	18
β-strand	519-524	6	2

Chain d: 24 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	29-47	19
α-helix	49-51	3
β-strand	58-62	5	63
β-strand	68-71	4	63
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-151	22
β-strand	153-154	2	86
α-helix	160-170	11
α-helix	177-179	3
α-helix	180-192	13
α-helix	205-207	3
β-strand	208-214	7	87
α-helix	218-220	3
β-strand	222-224	3	87
β-strand	227-229	3	88
α-helix	232	1
β-strand	233	1	88
β-strand	240-249	10	88
β-strand	262-266	5	19
α-helix	270-291	22
β-strand	297-301	5	88
α-helix	311-319	9
β-strand	323-328	6	88
α-helix	330-332	3
α-helix	333-340	8
β-strand	345	1	88
α-helix	348-350	3
α-helix	353-355	3
β-strand	357-366	10	88
β-strand	372-379	8	88
β-strand	386-392	7	87
α-helix	395-417	23
β-strand	420-423	4	86
α-helix	427-442	16
α-helix	446-456	11
α-helix	460-469	10
α-helix	473-485	13
β-strand	491-494	4	89
β-strand	499-502	4	89
β-strand	509-511	3	86
α-helix	512-529	18
β-strand	532-537	6	13

Chain D: 25 helices, 20 β-strands

Element	Residues	Length	Sheet
α-helix	29-47	19
α-helix	49-51	3
β-strand	58-62	5	1
β-strand	68-71	4	1
α-helix	74-80	7
α-helix	86-101	16
α-helix	106-125	20
α-helix	130-151	22
β-strand	153-154	2	30
α-helix	160-171	12
α-helix	177-179	3
α-helix	180-194	15
α-helix	205-207	3
β-strand	208-212	5	31
α-helix	218-220	3
β-strand	222-224	3	31
β-strand	226-229	4	32
β-strand	233	1	32
β-strand	240-249	10	32
β-strand	262-266	5	8
α-helix	269-292	24
β-strand	297-301	5	32
α-helix	311-319	9
β-strand	323-328	6	32
α-helix	330-332	3
α-helix	333-339	7
β-strand	345	1	32
α-helix	348-350	3
α-helix	353-355	3
α-helix	356	1
β-strand	357-366	10	32
β-strand	372-379	8	32
β-strand	386-390	5	31
α-helix	395-417	23
β-strand	420-423	4	30
α-helix	427-442	16
α-helix	446-457	12
α-helix	460-468	9
α-helix	473-485	13
β-strand	491-494	4	33
β-strand	499-502	4	33
α-helix	503-506	4
β-strand	509-511	3	30
α-helix	512-529	18
β-strand	535-537	3	34

8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
T-complex protein 1 subunit alpha	A, a	protein	556	Homo sapiens	P17987 (AlphaFold model)
T-complex protein 1 subunit beta	B, b	protein	535	Homo sapiens	P78371 (AlphaFold model)
T-complex protein 1 subunit gamma	C, c	protein	545	Homo sapiens	P49368 (AlphaFold model)
T-complex protein 1 subunit delta	D, d	protein	539	Homo sapiens	P50991 (AlphaFold model)
T-complex protein 1 subunit epsilon	E, e	protein	541	Homo sapiens	P48643
T-complex protein 1 subunit zeta	F, f	protein	531	Homo sapiens	P40227
T-complex protein 1 subunit eta	G, g	protein	543	Homo sapiens	Q99832
T-complex protein 1 subunit theta	H, h	protein	548	Homo sapiens	P50990

Sequence of entity 1 (A, a), FASTA

>9S72_1 T-complex protein 1 subunit alpha (chains A, a)
MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGAT
ILKLLEVEHPAAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISG
YRLACKEAVRYINENLIVNTDELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIK
YTDIRGQPRYPVNSVNILKAHGRSQMESMLISGYALNCVVGSQGMPKRIVNAKIACLDFS
LQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILATGANVILTTGGIDDMCLKYF
VEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEEVVQERICDDE
LILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS
IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPER
KNLKWIGLDLSNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDD
KHGSYEDAVHSGALND

Sequence of entity 2 (B, b), FASTA

>9S72_2 T-complex protein 1 subunit beta (chains B, b)
MASLSLAPVNIFKAGADEERAETARLTSFIGAIAIGDLVKSTLGPKGMDKILLSSGRDAS
LMVTNDGATILKNIGVDNPAAKVLVDMSRVQDDEVGDGTTSVTVLAAELLREAESLIAKK
IHPQTIIAGWREATKAAREALLSSAVDHGSDEVKFRQDLMNIAGTTLSSKLLTHHKDHFT
KLAVEAVLRLKGSGNLEAIHIIKKLGGSLADSYLDEGFLLDKKIGVNQPKRIENAKILIA
NTGMDTDKIKIFGSRVRVDSTAKVAEIEHAEKEKMKEKVERILKHGINCFINRQLIYNYP
EQLFGAAGVMAIEHADFAGVERLALVTGGEIASTFDHPELVKLGSCKLIEEVMIGEDKLI
HFSGVALGEACTIVLRGATQQILDEAERSLHDALCVLAQTVKDSRTVYGGGCSEMLMAHA
VTQLANRTPGKEAVAMESYAKALRMLPTIIADNAGYDSADLVAQLRAAHSEGNTTAGLDM
REGTIGDMAILGITESFQVKRQVLLSAAEAAEVILRVDNIIKAAPRKRVPDHHPC

Sequence of entity 3 (C, c), FASTA

>9S72_3 T-complex protein 1 subunit gamma (chains C, c)
MMGHRPVLVLSQNTKRESGRKVQSGNINAAKTIADIIRTCLGPKSMMKMLLDPMGGIVMT
NDGNAILREIQVQHPAAKSMIEISRTQDEEVGDGTTSVIILAGEMLSVAEHFLEQQMHPT
VVISAYRKALDDMISTLKKISIPVDISDSDMMLNIINSSITTKAISRWSSLACNIALDAV
KMVQFEENGRKEIDIKKYARVEKIPGGIIEDSCVLRGVMINKDVTHPRMRRYIKNPRIVL
LDSSLEYKKGESQTDIEITREEDFTRILQMEEEYIQQLCEDIIQLKPDVVITEKGISDLA
QHYLMRANITAIRRVRKTDNNRIARACGARIVSRPEELREDDVGTGAGLLEIKKIGDEYF
TFITDCKDPKACTILLRGASKEILSEVERNLQDAMQVCRNVLLDPQLVPGGGASEMAVAH
ALTEKSKAMTGVEQWPYRAVAQALEVIPRTLIQNCGASTIRLLTSLRAKHTQENCETWGV
NGETGTLVDMKELGIWEPLAVKLQTYKTAVETAVLLLRIDDIVSGHKKKGDDQSRQGGAP
DAGQE

Sequence of entity 4 (D, d), FASTA

>9S72_4 T-complex protein 1 subunit delta (chains D, d)
MPENVAPRSGATAGAAGGRGKGAYQDRDKPAQIRFSNISAAKAVADAIRTSLGPKGMDKM
IQDGKGDVTITNDGATILKQMQVLHPAARMLVELSKAQDIEAGDGTTSVVIIAGSLLDSC
TKLLQKGIHPTIISESFQKALEKGIEILTDMSRPVELSDRETLLNSATTSLNSKVVSQYS
SLLSPMSVNAVMKVIDPATATSVDLRDIKIVKKLGGTIDDCELVEGLVLTQKVSNSGITR
VEKAKIGLIQFCLSAPKTDMDNQIVVSDYAQMDRVLREERAYILNLVKQIKKTGCNVLLI
QKSILRDALSDLALHFLNKMKIMVIKDIEREDIEFICKTIGTKPVAHIDQFTADMLGSAE
LAEEVNLNGSGKLLKITGCASPGKTVTIVVRGSNKLVIEEAERSIHDALCVIRCLVKKRA
LIAGGGAPEIELALRLTEYSRTLSGMESYCVRAFADAMEVIPSTLAENAGLNPISTVTEL
RNRHAQGEKTAGINVRKGGISNILEELVVQPLLVSVSALTLATETVRSILKIDDVVNTR

Sequence of entity 5 (E, e), FASTA

>9S72_5 T-complex protein 1 subunit epsilon (chains E, e)
MASMGTLAFDEYGRPFLIIKDQDRKSRLMGLEALKSHIMAAKAVANTMRTSLGPNGLDKM
MVDKDGDVTVTNDGATILSMMDVDHQIAKLMVELSKSQDDEIGDGTTGVVVLAGALLEEA
EQLLDRGIHPIRIADGYEQAARVAIEHLDKISDSVLVDIKDTEPLIQTAKTTLGSKVVNS
CHRQMAEIAVNAVLTVADMERRDVDFELIKVEGKVGGRLEDTKLIKGVIVDKDFSHPQMP
KKVEDAKIAILTCPFEPPKPKTKHKLDVTSVEDYKALQKYEKEKFEEMIQQIKETGANLA
ICQWGFDDEANHLLLQNNLPAVRWVGGPEIELIAIATGGRIVPRFSELTAEKLGFAGLVQ
EISFGTTKDKMLVIEQCKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVIRNLIRDNRVVY
GGGAAEISCALAVSQEADKCPTLEQYAMRAFADALEVIPMALSENSGMNPIQTMTEVRAR
QVKEMNPALGIDCLHKGTNDMKQQHVIETLIGKKQQISLATQMVRMILKIDDIRKPGESE
E

Sequence of entity 6 (F, f), FASTA

>9S72_6 T-complex protein 1 subunit zeta (chains F, f)
MAAVKTLNPKAEVARAQAALAVNISAARGLQDVLRTNLGPKGTMKMLVSGAGDIKLTKDG
NVLLHEMQIQHPTASLIAKVATAQDDITGDGTTSNVLIIGELLKQADLYISEGLHPRIIT
EGFEAAKEKALQFLEEVKVSREMDRETLIDVARTSLRTKVHAELADVLTEAVVDSILAIK
KQDEPIDLFMIEIMEMKHKSETDTSLIRGLVLDHGARHPDMKKRVEDAYILTCNVSLEYE
KTEVNSGFFYKSAEEREKLVKAERKFIEDRVKKIIELKRKVCGDSDKGFVVINQKGIDPF
SLDALSKEGIVALRRAKRRNMERLTLACGGVALNSFDDLSPDCLGHAGLVYEYTLGEEKF
TFIEKCNNPRSVTLLIKGPNKHTLTQIKDAVRDGLRAVKNAIDDGCVVPGAGAVEVAMAE
ALIKHKPSVKGRAQLGVQAFADALLIIPKVLAQNSGFDLQETLVKIQAEHSESGQLVGVD
LNTGEPMVAAEVGVWDNYCVKKQLLHSCTVIATNILLVDEIMRAGMSSLKG

Sequence of entity 7 (G, g), FASTA

>9S72_7 T-complex protein 1 subunit eta (chains G, g)
MMPTPVILLKEGTDSSQGIPQLVSNISACQVIAEAVRTTLGPRGMDKLIVDGRGKATISN
DGATILKLLDVVHPAAKTLVDIAKSQDAEVGDGTTSVTLLAAEFLKQVKPYVEEGLHPQI
IIRAFRTATQLAVNKIKEIAVTVKKADKVEQRKLLEKCAMTALSSKLISQQKAFFAKMVV
DAVMMLDDLLQLKMIGIKKVQGGALEDSQLVAGVAFKKTFSYAGFEMQPKKYHNPKIALL
NVELELKAEKDNAEIRVHTVEDYQAIVDAEWNILYDKLEKIHHSGAKVVLSKLPIGDVAT
QYFADRDMFCAGRVPEEDLKRTMMACGGSIQTSVNALSADVLGRCQVFEETQIGGERYNF
FTGCPKAKTCTFILRGGAEQFMEETERSLHDAIMIVRRAIKNDSVVAGGGAIEMELSKYL
RDYSRTIPGKQQLLIGAYAKALEIIPRQLCDNAGFDATNILNKLRARHAQGGTWYGVDIN
NEDIADNFEAFVWEPAMVRINALTAASEAACLIVSVDETIKNPRSTVDAPTAAGRGRGRG
RPH

Sequence of entity 8 (H, h), FASTA

>9S72_8 T-complex protein 1 subunit theta (chains H, h)
MALHVPKAPGFAQMLKEGAKHFSGLEEAVYRNIQACKELAQTTRTAYGPNGMNKMVINHL
EKLFVTNDAATILRELEVQHPAAKMIVMASHMQEQEVGDGTNFVLVFAGALLELAEELLR
IGLSVSEVIEGYEIACRKAHEILPNLVCCSAKNLRDIDEVSSLLRTSIMSKQYGNEVFLA
KLIAQACVSIFPDSGHFNVDNIRVCKILGSGISSSSVLHGMVFKKETEGDVTSVKDAKIA
VYSCPFDGMITETKGTVLIKTAEELMNFSKGEENLMDAQVKAIADTGANVVVTGGKVADM
ALHYANKYNIMLVRLNSKWDLRRLCKTVGATALPRLTPPVLEEMGHCDSVYLSEVGDTQV
VVFKHEKEDGAISTIVLRGSTDNLMDDIERAVDDGVNTFKVLTRDKRLVPGGGATEIELA
KQITSYGETCPGLEQYAIKKFAEAFEAIPRALAENSGVKANEVISKLYAVHQEGNKNVGL
DIEAEVPAVKDMLEAGILDTYLGKYWAIKLATNAAVTVLRVDQIIMAKPAGGPKPPSGKK
DWDDDQND

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	16
MG	Magnesium ion	Mg	16
AF3	Aluminum fluoride	Al F3	16

Primary citation

CryoEM Strategies for Elucidating the Closed State Architecture of CCT. Gutierrez-Seijo, J., Cuervo, A., Pipaon, S. et al. Methods Mol Biol (2026) 3070:263-282. DOI 10.1007/978-1-0716-5515-3_15 · PubMed

Other PDB entries of the same protein (UniProt P17987 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NVL 2.5 Å, Human TRiC complex in closed state with nanobody bound (Consensus Map)
8SH9 2.7 Å, CCT G beta 5 complex best PhLP1 class
8SHE 2.8 Å, CCT-G beta 5 complex closed state 8
8SHG 2.8 Å, CCT G beta 5 complex closed state 9
8SHN 2.8 Å, CCT-G beta 5 complex closed state 6
7TTT 2.9 Å, The beta-tubulin folding intermediate III
8SG9 2.9 Å, CCT G beta 5 complex closed state 3
8SGC 2.9 Å, CCT G beta 5 complex closed state 2
8SGL 2.9 Å, CCT G beta 5 complex closed state 15
8SHD 2.9 Å, CCT G beta 5 complex closed state 10
8SHQ 2.9 Å, CCT G beta 5 complex closed state 12
9NOQ 2.9 Å, CCT G beta 5 R269E complex state 5

Browse structure collections

About this viewer

MolViewer shows 9S72 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.