9S86: Glycogen phosphorylase

Structure of glycogen phosphorylase - tetrameric form - from Escherichia coli. Determined by electron microscopy at 2.97 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 2.97 Å
Organism: Escherichia coli
Chains: 4
Atoms: 23,908
Mol. weight: 382.15 kDa
Released: 8 Apr 2026

Explore 9S86 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9S86 contains 191 α-helices and 98 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 43 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	14-23	10
α-helix	24-29	6
α-helix	38-65	28
β-strand	71-75	5	1
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-115	7
α-helix	125-140	16
β-strand	144-149	6	1
β-strand	157-161	5	2
β-strand	164-168	5	2
β-strand	183-192	10	1
β-strand	195-199	5	3
β-strand	202-206	5	3
β-strand	209-217	9	1
β-strand	220-221	2	4
α-helix	222	1
β-strand	228-229	2	4
β-strand	230-236	7	1
α-helix	253-255	3
α-helix	262-266	5
α-helix	270-271	2
α-helix	279-305	27
β-strand	315-318	4	1
α-helix	323-325	3
α-helix	327-339	13
α-helix	343-353	11
β-strand	354-357	4	1
β-strand	368-370	3	5
α-helix	371-375	5
α-helix	379-399	21
α-helix	404-410	7
β-strand	413-414	2	5
β-strand	420-422	3	5
α-helix	423-430	8
β-strand	433-435	3	1
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461	1	1
β-strand	468	1	6
α-helix	470-473	4
α-helix	479-489	11
α-helix	491-494	4
α-helix	497-501	5
α-helix	502-505	4
α-helix	513-535	23
β-strand	544-549	6	7
α-helix	554-556	3
α-helix	559-574	16
β-strand	583-588	6	7
α-helix	596-614	19
β-strand	622-627	6	7
α-helix	632-641	10
β-strand	644-647	4	7
α-helix	649-650	2
α-helix	659-666	8
β-strand	669-673	5	7
α-helix	677-685	9
β-strand	691-693	3	7
α-helix	697-706	10
α-helix	710-716	7
α-helix	719-728	10
α-helix	741-749	9
α-helix	760-775	16
α-helix	777-789	13
α-helix	792-794	3
β-strand	795	1	6
α-helix	796-806	11

Chain B: 48 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	14-23	10
α-helix	24-30	7
α-helix	38-67	30
β-strand	71-75	5	8
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-140	16
β-strand	144-149	6	8
β-strand	157-161	5	9
β-strand	164-168	5	9
α-helix	180	1
β-strand	181-190	10	8
β-strand	195-199	5	10
β-strand	202-206	5	10
β-strand	211-220	10	8
β-strand	229-238	10	8
α-helix	252-256	5
α-helix	259-266	8
α-helix	278-302	25
α-helix	311-313	3
β-strand	315-318	4	8
α-helix	323-326	4
α-helix	327-338	12
α-helix	343-350	8
β-strand	355-357	3	11
β-strand	368-370	3	12
α-helix	371-377	7
α-helix	379-399	21
α-helix	406-408	3
β-strand	413-414	2	12
β-strand	420-422	3	12
α-helix	423-430	8
β-strand	433-436	4	11
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	11
β-strand	468	1	13
α-helix	470-473	4
α-helix	479-489	11
α-helix	492-494	3
α-helix	497-503	7
α-helix	510-535	26
β-strand	545-547	3	14
α-helix	554-556	3
α-helix	559-574	16
α-helix	580-582	3
β-strand	584-587	4	14
α-helix	590-592	3
α-helix	596-612	17
α-helix	619-621	3
β-strand	623-626	4	14
α-helix	632-641	10
β-strand	644-647	4	14
α-helix	649-650	2
α-helix	658-665	8
β-strand	669-673	5	14
α-helix	677-685	9
α-helix	687-689	3
β-strand	691-693	3	14
α-helix	697-706	10
α-helix	711-716	6
α-helix	718-729	12
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-790	14
α-helix	792-794	3
β-strand	795	1	13
α-helix	796-803	8
α-helix	804-808	5

Chain C: 51 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	14-23	10
α-helix	24-30	7
α-helix	38-67	30
β-strand	71-75	5	15
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-113	5
α-helix	117-119	3
α-helix	125-140	16
β-strand	144-149	6	15
β-strand	157-159	3	16
β-strand	166-168	3	16
α-helix	180	1
β-strand	181-192	12	15
β-strand	195-198	4	17
β-strand	203-206	4	17
β-strand	209-220	12	15
β-strand	229-239	11	15
α-helix	243-245	3
α-helix	252-256	5
α-helix	259-266	8
α-helix	276-278	3
α-helix	279-302	24
α-helix	311-313	3
β-strand	315-318	4	15
α-helix	324-326	3
α-helix	327-339	13
α-helix	343-350	8
β-strand	355-358	4	18
β-strand	368-370	3	19
α-helix	371-377	7
α-helix	379-399	21
α-helix	404-410	7
β-strand	413-414	2	19
α-helix	415-417	3
β-strand	420-422	3	19
α-helix	423-430	8
β-strand	433-436	4	18
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	18
β-strand	468	1	20
α-helix	470-473	4
α-helix	479-489	11
α-helix	492-494	3
α-helix	497-505	9
α-helix	510-535	26
β-strand	544-547	4	21
α-helix	554-556	3
α-helix	559-574	16
α-helix	580-582	3
β-strand	583-587	5	21
α-helix	590-592	3
α-helix	596-614	19
α-helix	619-621	3
β-strand	622-626	5	21
α-helix	632-641	10
β-strand	644-647	4	21
α-helix	649-650	2
α-helix	658-665	8
β-strand	669-673	5	21
α-helix	677-685	9
α-helix	687-689	3
β-strand	691-693	3	21
α-helix	697-706	10
α-helix	710-716	7
α-helix	719-728	10
α-helix	741-749	9
α-helix	760-774	15
α-helix	777-789	13
α-helix	792-794	3
β-strand	795	1	20
α-helix	796-803	8
α-helix	804-808	5

Chain D: 49 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	14-23	10
α-helix	24-29	6
α-helix	33-35	3
α-helix	38-41	4
α-helix	43-67	25
β-strand	71-75	5	22
α-helix	85-92	8
α-helix	95-104	10
α-helix	109-115	7
α-helix	117-119	3
α-helix	125-140	16
β-strand	144-149	6	22
β-strand	157-161	5	23
β-strand	164-168	5	23
β-strand	183-192	10	22
β-strand	195-199	5	24
β-strand	202-206	5	24
β-strand	209-221	13	22
α-helix	222	1
β-strand	228-238	11	22
α-helix	252-256	5
α-helix	259-266	8
α-helix	276-305	30
α-helix	311-313	3
β-strand	315-318	4	22
α-helix	324-326	3
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	22
α-helix	363-365	3
β-strand	368-370	3	25
α-helix	371-375	5
α-helix	379-399	21
α-helix	404-410	7
β-strand	413-414	2	25
α-helix	415-417	3
β-strand	420-422	3	25
α-helix	423-430	8
β-strand	433-436	4	22
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	22
β-strand	468	1	26
α-helix	470-473	4
α-helix	479-489	11
α-helix	491-494	4
α-helix	497-503	7
α-helix	512-530	19
α-helix	531-535	5
β-strand	544-549	6	27
α-helix	554-556	3
α-helix	558-574	17
β-strand	583-588	6	27
α-helix	596-614	19
β-strand	622-627	6	27
α-helix	632-641	10
β-strand	644-647	4	27
α-helix	650	1
α-helix	659-665	7
β-strand	669-673	5	27
α-helix	677-685	9
β-strand	691-693	3	27
α-helix	697-706	10
α-helix	710-716	7
α-helix	719-728	10
α-helix	741-749	9
α-helix	756-774	19
α-helix	777-789	13
α-helix	792-794	3
β-strand	795	1	26
α-helix	796-803	8
α-helix	804-808	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen phosphorylase	A, B, C, D	protein	832	Escherichia coli	P0AC86 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>9S86_1 Glycogen phosphorylase (chains A, B, C, D)
MHHHHHHENLYFQGSGAMNAPFTYSSPTLSVEALKHSIAYKLMFTIGKDPVVANKHEWLN
ATLFAVRDRLVERWLRSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALE
AMGLNLEELIDEENDPGLGNGGLGRLAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNG
SQKESPDYWLEYGNPWEFKRHNTRYKVRFGGRIQQEGKKTRWIETEEILGVAYDQIIPGY
DTDATNTLRLWSAQASSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRL
RQEYFLVSSTIQDILSRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSW
DDAFEVCCQVFSYTNHTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPND
TDLLGRASIIDESNGRRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTN
VTNGVTPRRWLAVANPSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLEN
KKRLAEYIAQQLNVVVNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAKWVPR
VNIFGGKAASAYYMAKHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAAD
LSEQISLAGTEASGTSNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEEL
RRQGYKPREYYEKDEELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRSY
VDCQDKVDELYELQEEWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVRL

Primary citation

Structural basis for phosphorylation and allosteric regulation of bacterial glycogen phosphorylase by histidine phosphocarrier protein. Di Domenico, V., Franceus, J., Mastrella, L. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-71729-w · PubMed

Other PDB entries of the same protein (UniProt P0AC86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
9M9P 2.93 Å, Glycogen phosphorylase dimer from E. coli
9S7V 3.1 Å, Structure of glycogen phosphorylase - dimeric form - from Escherichia coli
9V16 3.45 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant in complex with AMP
9UKQ 3.5 Å, Crystal structure of glycogen phosphorylase from Escherichia coli
9UKR 3.55 Å, Crystal structure of glycogen phosphorylase from E. coli in complex with AMP
9V17 3.7 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant

Browse structure collections

About this viewer

MolViewer shows 9S86 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.