Cryo-EM structure of H. neapolitanus CsoSCA C283A/C284A inactive mutant, dimer, state 2. Determined by electron microscopy at 2.22 Å resolution. Released 22 Apr 2026.
Explore 9SKZ in 3D Show helices and sheets RCSB PDB PDBe
9SKZ contains 56 α-helices and 28 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-51 | 3 | |
| α-helix | 56-74 | 19 | |
| α-helix | 76-83 | 8 | |
| α-helix | 87 | 1 | |
| α-helix | 92-104 | 13 | |
| α-helix | 110-112 | 3 | |
| α-helix | 116-119 | 4 | |
| α-helix | 123-143 | 21 | |
| α-helix | 151-162 | 12 | |
| β-strand | 165-172 | 8 | 1 |
| β-strand | 173 | 1 | 2 |
| α-helix | 176-178 | 3 | |
| α-helix | 181-186 | 6 | |
| β-strand | 191 | 1 | 1 |
| β-strand | 194-196 | 3 | 1 |
| β-strand | 199 | 1 | 2 |
| α-helix | 206-223 | 18 | |
| β-strand | 234-243 | 10 | 1 |
| α-helix | 254-256 | 3 | |
| α-helix | 260-282 | 23 | |
| α-helix | 285-287 | 3 | |
| β-strand | 288-296 | 9 | 1 |
| β-strand | 302-305 | 4 | 1 |
| α-helix | 306-307 | 2 | |
| β-strand | 318-320 | 3 | 1 |
| α-helix | 321-328 | 8 | |
| α-helix | 333-348 | 16 | |
| α-helix | 352-354 | 3 | |
| α-helix | 362-386 | 25 | |
| α-helix | 392-395 | 4 | |
| β-strand | 401-405 | 5 | 3 |
| β-strand | 417-420 | 4 | 3 |
| α-helix | 425-442 | 18 | |
| α-helix | 444-446 | 3 | |
| α-helix | 448-449 | 2 | |
| β-strand | 450-458 | 9 | 3 |
| α-helix | 465-483 | 19 | |
| α-helix | 485-489 | 5 | |
| β-strand | 493-501 | 9 | 3 |
| α-helix | 506-508 | 3 | |
| β-strand | 509-511 | 3 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 49-51 | 3 | |
| α-helix | 56-74 | 19 | |
| α-helix | 76-83 | 8 | |
| α-helix | 87 | 1 | |
| α-helix | 92-104 | 13 | |
| α-helix | 110-113 | 4 | |
| α-helix | 116-119 | 4 | |
| α-helix | 123-147 | 25 | |
| α-helix | 150-162 | 13 | |
| β-strand | 165-172 | 8 | 4 |
| β-strand | 173 | 1 | 5 |
| α-helix | 176-178 | 3 | |
| α-helix | 181-186 | 6 | |
| β-strand | 191 | 1 | 4 |
| β-strand | 194-196 | 3 | 4 |
| β-strand | 199 | 1 | 5 |
| α-helix | 200-202 | 3 | |
| α-helix | 206-222 | 17 | |
| β-strand | 234-243 | 10 | 4 |
| α-helix | 254-256 | 3 | |
| α-helix | 260-282 | 23 | |
| α-helix | 285-287 | 3 | |
| β-strand | 288-296 | 9 | 4 |
| β-strand | 302-305 | 4 | 4 |
| α-helix | 306-307 | 2 | |
| β-strand | 318-320 | 3 | 4 |
| α-helix | 321-328 | 8 | |
| α-helix | 333-348 | 16 | |
| α-helix | 352-354 | 3 | |
| α-helix | 359-361 | 3 | |
| α-helix | 362-386 | 25 | |
| α-helix | 392-394 | 3 | |
| β-strand | 401-405 | 5 | 6 |
| β-strand | 417-421 | 5 | 6 |
| α-helix | 425-442 | 18 | |
| α-helix | 444-446 | 3 | |
| α-helix | 448-449 | 2 | |
| β-strand | 450-458 | 9 | 6 |
| α-helix | 465-483 | 19 | |
| α-helix | 485-489 | 5 | |
| β-strand | 493-501 | 9 | 6 |
| α-helix | 506-507 | 2 | |
| β-strand | 508-511 | 4 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maltose/maltodextrin-binding periplasmic protein,Carboxysome shell carbonic anhydrase | A, B | protein | 919 | Escherichia coli K-12, Halothiobacillus neapolitanus c2 | O85042 (AlphaFold model), P0AEX9 (AlphaFold model) |
>9SKZ_1 Maltose/maltodextrin-binding periplasmic protein,Carboxysome shell carbonic anhydrase (chains A, B) MWSHPQFEKGSSMKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKF PQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYP IAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGY AFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTIN GPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTD EGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAV INAASGRQTVDEALKDAQTNSSSNNNNNNNNNNLGIEENLYFQSNANTRNTRSKQRAPFG VSSSVKPRLDLIEQAPNPAYDRHPACITLPERTCRHPLTDLEANEQLGRCEDSVKNRFDR VIPFLQVVAGIPLGLDYVTRVQELAQSSLGHTLPEELLKDNWISGHNLKGIFGYATAKAL TAATEQFSRKIMSEKDDSASAIGFFLDCGFHAVDISPCADGRLKGLLPYILRLPLTAFTY RKAYAGSMFDIEDDLAQWEKNELRRYREGVPNTADQPTRYLKIAVYHFSTSDPTHSGCAA HGSNDRAALEAALTQLMKFREAVENAHAAGASIDILLIGVDTDTDAIRVHIPDSKGFLNP YRYVDNTVTYAQTLHLAPDEARVIIHEAILNANRSDGWAKGNGVASEGMRRFIGQLLINN LSQIDYVVNRHGGRYPPNDIGHAERYISVGDGFDEVQIRNLAYYAHLDTVEENAIDVDVG IKIFTKLNLSRGLPIPIAIHYRYDPNVPGSRERTVVKARRIYNAIKERFSSLDEQNLLQF RLSVQAQDIGSPIEEVASA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 2 |
Molecular mechanism of redox regulation of the alpha-carboxysomal carbonic anhydrase CsoSCA. Vogiatzi, N., Gaullier, G., Leufstadius, J. et al. bioRxiv (2026). DOI 10.64898/2026.04.02.716132
Other PDB entries of the same protein (UniProt O85042 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9SKZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.