9SL1: GABA-A a4b3d receptor
GABA-A a4b3d receptor in complex with GABA, Nb24 and Mb30. Determined by electron microscopy at 2.68 Å resolution. Released 2 Sept 2026.
- Method
- Electron microscopy
- Resolution
- 2.68 Å
- Organisms
- Homo sapiens, Escherichia coli, Lama glama
- Chains
- 9
- Atoms
- 17,537
- Mol. weight
- 299.33 kDa
- Ligands
- PX6, NAG, ABU, D10
- Released
- 2 Sept 2026
Explore 9SL1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9SL1 contains 68 α-helices and 117 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 13 helices, 16 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-21 | 10 | |
| α-helix | 36 | 1 | |
| β-strand | 37-52 | 16 | 1 |
| β-strand | 57-69 | 13 | 1 |
| α-helix | 71-73 | 3 | |
| β-strand | 81-84 | 4 | 1 |
| α-helix | 86-89 | 4 | |
| β-strand | 97-99 | 3 | 2 |
| β-strand | 102 | 1 | 1 |
| β-strand | 106-107 | 2 | 1 |
| β-strand | 111 | 1 | 3 |
| β-strand | 115 | 1 | 1 |
| β-strand | 117-120 | 4 | 1 |
| β-strand | 124-136 | 13 | 1 |
| β-strand | 148-157 | 10 | 2 |
| β-strand | 165-169 | 5 | 1 |
| β-strand | 177-178 | 2 | 1 |
| α-helix | 181-183 | 3 | |
| β-strand | 184 | 1 | 1 |
| β-strand | 189-202 | 14 | 2 |
| β-strand | 207-219 | 13 | 2 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-229 | 5 | |
| α-helix | 230-241 | 12 | |
| α-helix | 242-244 | 3 | |
| α-helix | 250-271 | 22 | |
| α-helix | 276-277 | 2 | |
| α-helix | 283-307 | 25 | |
| α-helix | 313-414 | 30 | |
Chain B: 13 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 28 | 1 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 4 |
| β-strand | 56-68 | 13 | 4 |
| α-helix | 70-72 | 3 | |
| β-strand | 74 | 1 | 5 |
| β-strand | 82-83 | 2 | 4 |
| α-helix | 85-89 | 5 | |
| β-strand | 96-98 | 3 | 3 |
| β-strand | 101-106 | 6 | 4 |
| β-strand | 110 | 1 | 6 |
| β-strand | 114-118 | 5 | 4 |
| β-strand | 123-135 | 13 | 4 |
| β-strand | 147-156 | 10 | 3 |
| β-strand | 164-168 | 5 | 4 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 4 |
| β-strand | 186-199 | 14 | 3 |
| β-strand | 204-216 | 13 | 3 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-237 | 11 | |
| α-helix | 238-240 | 3 | |
| α-helix | 247-268 | 22 | |
| α-helix | 280-306 | 27 | |
| α-helix | 418-446 | 29 | |
Chain C: 13 helices, 14 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 12-20 | 9 | |
| α-helix | 36 | 1 | |
| β-strand | 37-52 | 16 | 7 |
| β-strand | 57-69 | 13 | 7 |
| α-helix | 71-73 | 3 | |
| β-strand | 81-84 | 4 | 7 |
| α-helix | 86-91 | 6 | |
| β-strand | 97-99 | 3 | 6 |
| β-strand | 102-107 | 6 | 7 |
| β-strand | 111 | 1 | 8 |
| β-strand | 115-120 | 6 | 7 |
| β-strand | 124-136 | 13 | 7 |
| α-helix | 141-143 | 3 | |
| β-strand | 150-157 | 8 | 6 |
| β-strand | 165-169 | 5 | 7 |
| β-strand | 177-178 | 2 | 7 |
| α-helix | 181-183 | 3 | |
| β-strand | 184 | 1 | 7 |
| β-strand | 189-203 | 15 | 6 |
| β-strand | 206-219 | 14 | 6 |
| α-helix | 222-224 | 3 | |
| α-helix | 225-229 | 5 | |
| α-helix | 230-241 | 12 | |
| α-helix | 242-244 | 3 | |
| α-helix | 250-269 | 20 | |
| α-helix | 283-311 | 29 | |
| α-helix | 313-415 | 31 | |
Chain D: 12 helices, 15 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-20 | 12 | |
| α-helix | 28 | 1 | |
| α-helix | 35 | 1 | |
| β-strand | 36-51 | 16 | 9 |
| β-strand | 56-68 | 13 | 9 |
| α-helix | 70-72 | 3 | |
| β-strand | 73-74 | 2 | 10 |
| β-strand | 81-83 | 3 | 9 |
| α-helix | 85-90 | 6 | |
| β-strand | 96-98 | 3 | 8 |
| β-strand | 101-106 | 6 | 9 |
| β-strand | 108 | 1 | 11 |
| β-strand | 112 | 1 | 11 |
| β-strand | 114-118 | 5 | 9 |
| β-strand | 123-135 | 13 | 9 |
| β-strand | 147-156 | 10 | 8 |
| β-strand | 164-168 | 5 | 9 |
| α-helix | 171-173 | 3 | |
| β-strand | 175-176 | 2 | 9 |
| β-strand | 186-199 | 14 | 8 |
| β-strand | 204-216 | 13 | 8 |
| α-helix | 219-221 | 3 | |
| α-helix | 222-226 | 5 | |
| α-helix | 227-241 | 15 | |
| α-helix | 247-269 | 23 | |
| α-helix | 280-306 | 27 | |
| α-helix | 423-446 | 24 | |
Chain E: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 20-24 | 5 | |
| β-strand | 40-55 | 16 | 12 |
| β-strand | 60-72 | 13 | 12 |
| β-strand | 85-87 | 3 | 12 |
| α-helix | 89-94 | 6 | |
| β-strand | 100-102 | 3 | 13 |
| β-strand | 105-110 | 6 | 12 |
| β-strand | 114 | 1 | 2 |
| β-strand | 118-122 | 5 | 12 |
| β-strand | 127-139 | 13 | 12 |
| β-strand | 151-160 | 10 | 13 |
| β-strand | 168-172 | 5 | 12 |
| α-helix | 176-179 | 4 | |
| β-strand | 190-200 | 11 | 13 |
| β-strand | 212-221 | 10 | 13 |
| α-helix | 222 | 1 | |
| α-helix | 224-226 | 3 | |
| α-helix | 227-231 | 5 | |
| α-helix | 232-243 | 12 | |
| α-helix | 244-246 | 3 | |
| α-helix | 252-274 | 23 | |
| α-helix | 285-310 | 26 | |
| α-helix | 315-415 | 29 | |
Chain F: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-5 | 3 | 14 |
| β-strand | 405-412 | 8 | 14 |
| α-helix | 416-418 | 3 | |
| β-strand | 419-426 | 8 | 15 |
| β-strand | 432-438 | 7 | 15 |
| β-strand | 446-448 | 3 | 15 |
| β-strand | 457-461 | 5 | 14 |
| β-strand | 466-471 | 6 | 14 |
| α-helix | 476-478 | 3 | |
| β-strand | 480-488 | 9 | 15 |
| β-strand | 506-507 | 2 | 15 |
| β-strand | 511-513 | 3 | 15 |
Chain G: 1 helix, 13 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 16 |
| β-strand | 12-13 | 2 | 17 |
| β-strand | 18-25 | 8 | 16 |
| β-strand | 34-38 | 5 | 18 |
| β-strand | 46-51 | 6 | 18 |
| β-strand | 58-60 | 3 | 18 |
| β-strand | 69-73 | 5 | 16 |
| β-strand | 78-83 | 6 | 16 |
| α-helix | 88-90 | 3 | |
| β-strand | 92-97 | 6 | 18 |
| β-strand | 101 | 1 | 5 |
| β-strand | 115 | 1 | 16 |
| β-strand | 117-119 | 3 | 18 |
| β-strand | 121-122 | 2 | 17 |
Chain H: 2 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3-7 | 5 | 19 |
| β-strand | 405-412 | 8 | 19 |
| α-helix | 416-418 | 3 | |
| β-strand | 419-426 | 8 | 20 |
| β-strand | 432-438 | 7 | 20 |
| β-strand | 446-448 | 3 | 20 |
| β-strand | 456-461 | 6 | 19 |
| β-strand | 466-471 | 6 | 19 |
| α-helix | 476-478 | 3 | |
| β-strand | 480-488 | 9 | 20 |
| β-strand | 506-507 | 2 | 20 |
| β-strand | 511-513 | 3 | 20 |
1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Gamma-aminobutyric acid receptor subunit alpha-4 | A, C | protein | 364 | Homo sapiens | P48169 (AlphaFold model) |
| Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 | B, D | protein | 451 | Homo sapiens, Escherichia coli | P0ABE7 (AlphaFold model), P28472 (AlphaFold model) |
| GABA-A receptor SBP-delta-glvi,Gamma-aminobutyric acid receptor subunit delta,Gamma-aminobutyric… | E | protein | 430 | Homo sapiens | O14764 (AlphaFold model) |
| Megabody Mb30 | F, H | protein | 138 | Lama glama | |
| Nanobody Nb24 | G, I | protein | 133 | Lama glama | |
Sequence of entity 1 (A, C), FASTA
>9SL1_1 Gamma-aminobutyric acid receptor subunit alpha-4 (chains A, C)
GNSKDEKLCPENFTRILDSLLDGYDNRLRPGFGGPVTEVKTDIYVTSFGPVSDVEMEYTM
DVFFRQTWIDKRLKYDGPIEILRLNNMMVTKVWTPDTFFRNGKKSVSHNMTAPNKLFRIT
RNGTILYTMRLTISAECPMRLVDFPMDGHACPLKFGSYAYPKSEMIYTWTKGPEKSVEVP
KESSSLVQYDLIGQTVSSETIKSITGEYIVMTVYFHLRRKMGYFMIQTYIPCIMTVILSQ
VSFWINKESVPARTVFGITTVLTMTTLSISARHSLPKVSYATAMDWFIAVCFAFVFSALI
EFAAVNYFTNSQPARAAKIDKYARILFPVTFGAFNMVYWVVYLSKDTMEKSESLMGTKHH
HHHH
Sequence of entity 2 (B, D), FASTA
>9SL1_2 Gamma-aminobutyric acid receptor subunit beta-3,Soluble cytochrome b562 (chains B, D)
QSVNDPGNMSFVKETVDKLLKGYDIRLRPDFGGPPVCVGMNIDIASIDMVSEVNMDYTLT
MYFQQYWRDKRLAYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRMIRLHP
DGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWRGGDKAVTGVER
IELPQFSIVEHRLVSRNVVFATGAYPRLSLSFRLKRNIGYFILQTYMPSILITILSWVSF
WINYDASAARVALGITTVLTMTTINTHLRETLPKIPYVKAIDMYLMGCFVFVFLALLEYA
FVNYIFFSQPAGTADLEDNWETLNDNLKVIEKADNAAQVKDALTKMRAAALDAQKATPPK
LEDKSPDSPEMKDFRHGFDILVGQIDDALKLANEGKVKEAQAAAEQLKTTRNAYIQKYLT
GRAAAIDRWSRIVFPFTFSLFNLVYWLYYVN
Sequence of entity 3 (E), FASTA
>9SL1_3 GABA-A receptor SBP-delta-glvi,Gamma-aminobutyric acid receptor subunit delta,Gamma-aminobutyric acid receptor subunit delta (chains E)
MGILPSPGMPALLSLVSLLSVLLMGCVAEMDEKTTGWRGGHVVEGLAGELEQLRARLEHH
PQGQREPDYDIPTTENLYFQGTGAMNDIGDYVGSNLEISWLPNLDGLIAGYARNFRPGIG
GPPVNVALALEVASIDHISEANMEYTMTVFLHQSWRDSRLSYNHTNETLGLDSRFVDKLW
LPDTFIVNAKSAWFHDVTVENKLIRLQPDGVILYSIRITSTVACDMDLAKYPMDEQECML
DLESYGYSSEDIVYYWSESQEHIHGLDKLQLAQFTITSYRFTTELMNFKSAGQFPRLSLH
FHLRRNRGVYIIQSYMPSVLLVAMSWVSFWISQAAVPARVSLGITTVLTMTTLMVSARSS
LPRASAIKALDVYFWICYVFVFAALVEYAFAHFNADSQPARAATIDIYARAVFPAAFAAV
NVIYWAAYAM
Sequence of entity 4 (F, H), FASTA
>9SL1_4 Megabody Mb30 (chains F, H)
QVQLQESGGGLVQGSLRLSCTASQLTFSNYHMAWFRQLPGKEREFVAAISAGWGGNTAYG
TSIRGRFTISRDDAKNTAYLQMNSLKPEDTAVYYCAARNAVRPSWFAVKQTESAYDYWGQ
GTQVTVSSHHHHHHEPEA
Sequence of entity 5 (G, I), FASTA
>9SL1_5 Nanobody Nb24 (chains G, I)
QVQLQESGGGLVQAGDSLRLSCAASGRSIRNYHMGWFRQAPGKERDFVAAILWSGSSTFY
ADSVKGRFTVSRDNAKNTVYLQMNSLKPEDTAVYYCALHRGGSEDSPQAYDSWGQGTQVT
VSSHHHHHHEPEA
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| PX6 | 1,2-dipalmitoyl-sn-glycero-3-phosphate | C35 H68 O8 P | 1 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 7 |
| ABU | Gamma-amino-butanoic acid | C4 H9 N O2 | 2 |
| D10 | Decane | C10 H22 | 4 |
Primary citation
Molecular arrangement and modulation of extrasynaptic alpha beta delta GABA A receptors. Nestorow, S.A., Chen, W.N., Bertrand, D. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-76879-5 · PubMed
Other PDB entries of the same protein (UniProt P48169 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 7QN5 2.5 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
- 7QN9 2.9 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
- 7QNC 2.9 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
- 7QN7 3.0 Å, Cryo-EM structure of human full-length extrasynaptic alpha4beta3delta GABA(A)R in…
- 7QNA 3.0 Å, Cryo-EM structure of human full-length alpha4beta3gamma2 GABA(A)R in complex with GABA…
- 9SLD 3.04 Å, GABA-A a4b3d receptor in complex with DS2-Me, GABA, Nb24 and Mb30
Browse structure collections
About this viewer
MolViewer shows 9SL1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.