9SN2: RuvB-like 1

Cryo-EM reconstruction of the RUVBL1-RUVBL2-CCDC103 (R2C) complex. Determined by electron microscopy at 3.2 Å resolution. Released 30 Sept 2026.

Method: Electron microscopy
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 9
Atoms: 20,106
Mol. weight: 400.27 kDa
Ligands: ADP
Released: 30 Sept 2026

Explore 9SN2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9SN2 contains 141 α-helices and 127 β-strands across 9 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 22 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
β-strand	50	1	1
β-strand	56	1	1
β-strand	59-60	2	2
β-strand	63-64	2	2
α-helix	67-81	15
β-strand	89-93	5	3
α-helix	100-111	12
β-strand	117-121	5	3
α-helix	122-124	3
α-helix	132-142	11
β-strand	144-163	20	4
β-strand	181-186	6	4
β-strand	191-196	6	4
α-helix	201-206	6
β-strand	213-218	6	4
β-strand	224-230	7	4
β-strand	244-245	2	4
β-strand	254-263	10	4
α-helix	264-270	7
α-helix	297-313	17
β-strand	316-320	5	4
β-strand	322-326	5	3
α-helix	328-330	3
α-helix	333-344	12
α-helix	349	1
β-strand	350-355	6	3
β-strand	360-361	2	5
α-helix	362	1
β-strand	369-370	2	5
α-helix	371-373	3
α-helix	376-379	4
β-strand	382-386	5	3
α-helix	389-391	3
α-helix	392-406	15
β-strand	410	1	6
α-helix	412-424	13
α-helix	427-432	6
α-helix	434-443	10
β-strand	449	1	6
α-helix	451-460	10
β-strand	462	1	7
α-helix	464-474	11

Chain B: 21 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
β-strand	50	1	15
β-strand	56	1	15
β-strand	59-60	2	16
β-strand	63-64	2	16
α-helix	67-81	15
β-strand	89-93	5	17
α-helix	100-111	12
β-strand	117-121	5	17
α-helix	122-124	3
α-helix	132-142	11
β-strand	144-163	20	18
β-strand	181-186	6	18
β-strand	191-196	6	18
α-helix	201-206	6
β-strand	213-218	6	18
β-strand	224-230	7	18
β-strand	244-245	2	18
β-strand	254-263	10	18
α-helix	264-270	7
α-helix	297-313	17
β-strand	316-320	5	18
β-strand	322-326	5	17
α-helix	328-330	3
β-strand	332	1	19
α-helix	333-344	12
α-helix	349	1
β-strand	350-355	6	17
β-strand	360-361	2	20
α-helix	362	1
β-strand	363	1	19
β-strand	369-370	2	20
α-helix	371-373	3
α-helix	376-379	4
β-strand	382-386	5	17
α-helix	389-391	3
α-helix	392-406	15
β-strand	410	1	21
α-helix	412-424	13
α-helix	427-432	6
α-helix	434-443	10
β-strand	449	1	21
α-helix	451-460	10
β-strand	461-462	2	22
α-helix	464-474	11

Chain C: 21 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	40-42	3
β-strand	50	1	23
β-strand	56	1	23
β-strand	59-60	2	24
β-strand	63-64	2	24
α-helix	67-81	15
β-strand	89-93	5	25
α-helix	100-111	12
β-strand	117-121	5	25
α-helix	122-124	3
α-helix	132-142	11
β-strand	144-163	20	26
β-strand	181-186	6	26
β-strand	191-196	6	26
α-helix	201-206	6
β-strand	213-218	6	26
β-strand	224-230	7	26
β-strand	244-245	2	26
β-strand	254-263	10	26
α-helix	264-270	7
α-helix	297-313	17
β-strand	316-320	5	26
β-strand	322-326	5	25
α-helix	328-330	3
β-strand	332	1	27
α-helix	333-343	11
α-helix	349	1
β-strand	350-355	6	25
β-strand	360-361	2	28
α-helix	362	1
β-strand	363	1	27
β-strand	369-370	2	28
α-helix	371-373	3
α-helix	376-379	4
β-strand	382-386	5	25
α-helix	389-391	3
α-helix	392-406	15
β-strand	410	1	29
α-helix	412-424	13
α-helix	427-432	6
α-helix	434-443	10
β-strand	449	1	29
α-helix	451-460	10
β-strand	462	1	10
α-helix	464-474	11

Chain D: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	8
β-strand	39	1	8
β-strand	42-43	2	9
β-strand	46-47	2	9
α-helix	50-65	16
β-strand	72-77	6	10
α-helix	83-94	12
β-strand	100-104	5	10
α-helix	115-125	11
β-strand	127-134	8	11
β-strand	237-243	7	11
α-helix	244-252	9
α-helix	259-262	4
α-helix	271-285	15
β-strand	289-293	5	11
β-strand	295-299	5	10
α-helix	301-303	3
β-strand	305	1	12
α-helix	306-317	12
α-helix	321-322	2
β-strand	323-328	6	10
β-strand	332-334	3	13
α-helix	335	1
β-strand	336	1	12
β-strand	341-343	3	13
α-helix	348-351	4
β-strand	354-359	6	10
α-helix	364-378	15
β-strand	382	1	14
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	14
α-helix	423-432	10
β-strand	433-434	2	3
α-helix	435	1
α-helix	436-445	10

Chain E: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	30
β-strand	39	1	30
β-strand	42-43	2	31
β-strand	46-47	2	31
α-helix	50-65	16
β-strand	72-76	5	7
α-helix	83-94	12
β-strand	100-104	5	7
α-helix	115-125	11
β-strand	127-134	8	32
β-strand	237-243	7	32
α-helix	244-252	9
α-helix	259-262	4
α-helix	271-286	16
β-strand	289-293	5	32
β-strand	295-299	5	7
α-helix	301-303	3
β-strand	305	1	33
α-helix	306-317	12
α-helix	321-322	2
β-strand	323-328	6	7
β-strand	332-334	3	34
α-helix	335	1
β-strand	336	1	33
β-strand	341-343	3	34
α-helix	348-351	4
β-strand	354-358	5	7
α-helix	364-378	15
β-strand	382	1	35
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	35
α-helix	423-432	10
β-strand	433-434	2	17
α-helix	435	1
α-helix	436-445	10

Chain F: 17 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	33	1	36
β-strand	39	1	36
β-strand	42-43	2	37
β-strand	46-47	2	37
α-helix	50-65	16
β-strand	72-76	5	22
α-helix	83-94	12
β-strand	100-104	5	22
α-helix	115-125	11
β-strand	127-134	8	38
β-strand	237-243	7	38
α-helix	244-252	9
α-helix	259-262	4
α-helix	271-285	15
β-strand	289-293	5	38
β-strand	295-299	5	22
α-helix	301-303	3
β-strand	305	1	39
α-helix	306-317	12
α-helix	321-322	2
β-strand	323-328	6	22
β-strand	332-334	3	40
α-helix	335	1
β-strand	336	1	39
β-strand	341-343	3	40
α-helix	348-351	4
β-strand	354-358	5	22
α-helix	364-378	15
β-strand	382	1	41
α-helix	384-396	13
α-helix	399-415	17
β-strand	421	1	41
α-helix	423-432	10
β-strand	433-434	2	25
α-helix	435	1
α-helix	436-445	10

Chains G and H: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	102-106	5
α-helix	107-112	6
α-helix	116-126	11
α-helix	128-135	8
α-helix	143-153	11
α-helix	160-170	11
α-helix	176-181	6
α-helix	185-201	17
α-helix	227-238	12

Chain I: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	102-106	5
α-helix	107-112	6
α-helix	116-126	11
α-helix	128-134	7
α-helix	143-153	11
α-helix	160-170	11
α-helix	176-181	6
α-helix	185-201	17
α-helix	227-238	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RuvB-like 1	A, B, C	protein	480	Homo sapiens	Q9Y265 (AlphaFold model)
RuvB-like 2	D, E, F	protein	471	Homo sapiens	Q9Y230 (AlphaFold model)
Dynein axonemal assembly factor 19	G, H, I	protein	242	Homo sapiens	Q8IW40 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>9SN2_1 RuvB-like 1 (chains A, B, C)
MGSSHHHHHHHHSSGENLYFQGSHMKIEEVKSTTKTQRIASHSHVKGLGLDESGLAKQAA
SGLVGQENAREACGVIVELIKSKKMAGRAVLLAGPPGTGKTALALAIAQELGSKVPFCPM
VGSEVYSTEIKKTEVLMENFRRAIGLRIKETKEVYEGEVTELTPCETENPMGGYGKTISH
VIIGLKTAKGTKQLKLDPSIFESLQKERVEAGDVIYIEANSGAVKRQGRCDTYATEFDLE
AEEYVPLPKGDVHKKKEIIQDVTLHDLDVANARPQGGQDILSMMGQLMKPKKTEITDKLR
GEINKVVNKYIDQGIAELVPGVLFVDEVHMLDIECFTYLHRALESSIAPIVIFASNRGNC
VIRGTEDITSPHGIPLDLLDRVMIIRTMLYTPQEMKQIIKIRAQTEGINISEEALNHLGE
IGTKTTLRYSVQLLTPANLLAKINGKDSIEKEHVEEISELFYDAKSSAKILADQQDKYMK

Sequence of entity 2 (D, E, F), FASTA

>9SN2_2 RuvB-like 2 (chains D, E, F)
MATVTATTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVL
EMIREGKIAGRAVLIAGQPGTGKTAIAMGMAQALGPDTPFTAIAGSEIFSLEMSKTEALT
QAFRRSIGVRIKEETEIIEGEVVEIQIDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIE
SLTKDKVQAGDVITIDKATGKISKLGRSFTRARDYDAMGSQTKFVQCPDGELQKRKEVVH
TVSLHEIDVINSRTQGFLALFSGDTGEIKSEVREQINAKVAEWREEGKAEIIPGVLFIDE
VHMLDIESFSFLNRALESDMAPVLIMATNRGITRIRGTSYQSPHGIPIDLLDRLLIVSTT
PYSEKDTKQILRIRCEEEDVEMSEDAYTVLTRIGLETSLRYAIQLITAASLVCRKRKGTE
VQVDDIKRVYSLFLDESRSTQYMKEYQDAFLFNELKGETMDTSWSHPQFEK

Sequence of entity 3 (G, H, I), FASTA

>9SN2_3 Dynein axonemal assembly factor 19 (chains G, H, I)
MERNDIINFKALEKELQAALTADEKYKRENAAKLRAVEQRVASYEEFRGIVLASHLKPLE
RKDKMGGKRTVPWNCHTIQGRTFQDVATEISPEKAPLQPETSADFYRDWRRHLPSGPERY
QALLQLGGPRLGCLFQTDVGFGLLGELLVALADHVGPADRAAVLGILCSLASTGRFTLNL
SLLSRAERESCKGLFQKLQAMGNPRSVKEGLSWEEQGLEEQSGGLQEEERLLQELLELYQ
VD

Ligands and cofactors

ID	Name	Formula	Copies
ADP	Adenosine-5'-diphosphate	C10 H15 N5 O10 P2	6

Primary citation

CCDC103-mediated assembly of the R2C complex links RUVBL1-RUVBL2 to Primary Ciliary Dyskinesia. Munoz-Hernandez, H., Wieczorek, M., Pal, M. To be published.

Other PDB entries of the same protein (UniProt Q9Y265 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2C9O 2.2 Å, 3D Structure of the human RuvB-like helicase RuvBL1
8QR1 2.4 Å, Cryo-EM structure of the human Tip60 complex
9EMA 2.4 Å, RUVBL1/2 in complex with ATP and CB-6644 inhibitor
6K0R 2.5 Å, Ruvbl1-Ruvbl2 with truncated domain II in complex with phosphorylated Cordycepin
9C57 2.75 Å, Reconstituted P400 Subcomplex of the human TIP60 complex
2XSZ 3.0 Å, The dodecameric human RuvBL1:RuvBL2 complex with truncated domains II
9CAE 3.07 Å, Cryo-EM structure of the reconstituted RuvBL lobe of the human TIP60 complex (composite…
7ZI4 3.2 Å, Cryo-EM structure of the human INO80 complex bound to a WT nucleosome
8X15 3.2 Å, Structure of nucleosome-bound SRCAP-C in the apo state
8X19 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-BeFx-bound state
8X1C 3.2 Å, Structure of nucleosome-bound SRCAP-C in the ADP-bound state
8XVT 3.2 Å, The core subcomplex of human NuA4/TIP60 complex

Browse structure collections

About this viewer

MolViewer shows 9SN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.