9T3L: Acl1 ankyrin repeat domain

Name: PDB 9T3L: Crystal structure of the Acl1 ankyrin repeat domain in complex with the second Rpl1 domain
Published: 2026-04-08
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ribosomal protein

Crystal structure of the Acl1 ankyrin repeat domain in complex with the second Rpl1 domain. Determined by X-ray diffraction at 2.55 Å resolution. Released 8 Apr 2026.

Method: X-ray diffraction
Resolution: 2.55 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 1,663
Mol. weight: 25.8 kDa
Released: 8 Apr 2026

Explore 9T3L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9T3L contains 16 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 4 β-strands

Element	Residues	Length	Sheet
β-strand	65-68	4	1
α-helix	71-80	10
β-strand	83-85	3	1
α-helix	87-91	5
α-helix	97-106	10
β-strand	109-113	5	1
α-helix	114-119	6
α-helix	120-124	5
α-helix	127-130	4
α-helix	134-135	2
β-strand	136-138	3	1
α-helix	144-150	7

Chain B: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	5-10	6
α-helix	14-23	10
α-helix	40-47	8
α-helix	50-59	10
α-helix	75-77	3
α-helix	81-89	9
α-helix	105-112	8
α-helix	116-126	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Large ribosomal subunit protein uL1A	A	protein	104	Saccharomyces cerevisiae	P0CX43 (AlphaFold model)
Ankyrin repeat-containing protein YCR051W	B	protein	128	Saccharomyces cerevisiae	P25631 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9T3L_1 Large ribosomal subunit protein uL1A (chains A)
MSICIFGDAFDVDRAKSCGVDAMSVDDLKKLNKNKKLIKKLSKKYNAFIASEVLIKQVPR
LLGPQLSKAGKFPTPVSHNDDLYGKVTDVRSTIKFQGSHHHHHH

Sequence of entity 2 (B), FASTA

>9T3L_2 Ankyrin repeat-containing protein YCR051W (chains B)
MNANIWVAASDGNLDRVEHILRESKGAMTPQSKDINGYTPMHAAAAYGHLDLLKKMCNEY
NGDINVLDNDGDTPLHHVEDVATARLIVEELGGDFTIRNVEGQTPYDSFVENGEDGELIE
YMRIKSGS

Primary citation

Exploration of the proxiOME of large subunit ribosomal proteins reveals Acl1 and Bcl1 as cooperating dedicated chaperones of Rpl1. Favre, S., Pillet, B., Burchert, F. et al. Nucleic Acids Res (2026) 54. DOI 10.1093/nar/gkag264 · PubMed

Other PDB entries of the same protein (UniProt P0CX43 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9DP7 2.38 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
7ZW0 2.4 Å, FAP-80S Complex - Rotated state
8AGX 2.4 Å, Yeast RQC complex in state with the RING domain of Ltn1 in the IN position
8BN3 2.4 Å, Yeast 80S, ES7s delta, eIF5A, Stm1 containing
8T2X 2.46 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, A-site tRNA, messenger…
9DOV 2.49 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
8AAF 2.5 Å, Yeast RQC complex in state G
8V83 2.53 Å, 60S ribosome biogenesis intermediate (Dbp10 pre-catalytic structure - Overall map)
8AGT 2.6 Å, Yeast RQC complex in state F
8AGV 2.6 Å, Yeast RQC complex in state H
8AGW 2.6 Å, Yeast RQC complex in state D
8AGZ 2.6 Å, Yeast RQC complex in state with the RING domain of Ltn1 in the OUT position

Browse structure collections

About this viewer

MolViewer shows 9T3L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.