9TDL: Complement C5 beta chain

Complex between complement C5 and cobra venom factor, re-refined. Determined by X-ray diffraction at 4.3 Å resolution. Released 29 Jul 2026.

Method: X-ray diffraction
Resolution: 4.3 Å
Organisms: Homo sapiens, Naja kaouthia
Chains: 10
Atoms: 45,369
Mol. weight: 657.41 kDa
Ligands: NAG
Released: 29 Jul 2026

Explore 9TDL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TDL contains 169 α-helices and 448 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 58 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	1
β-strand	31-32	2	2
β-strand	37-42	6	1
β-strand	50-58	9	3
β-strand	65-73	9	3
α-helix	75-77	3
β-strand	80-85	6	1
α-helix	98-99	2
β-strand	101-108	8	3
β-strand	112	1	3
β-strand	115-118	4	3
β-strand	119-120	2	2
β-strand	125-130	6	4
β-strand	134-135	2	5
β-strand	140-141	2	6
β-strand	143-148	6	4
β-strand	154	1	4
β-strand	159-164	6	5
β-strand	170-176	7	5
β-strand	182-184	3	4
α-helix	185-187	3
β-strand	188-189	2	6
α-helix	190-191	2
β-strand	197-205	9	5
β-strand	212-219	8	5
β-strand	221-222	2	7
β-strand	228-233	6	8
β-strand	237-238	2	9
β-strand	246-255	10	8
β-strand	258-259	2	8
β-strand	262-272	11	9
β-strand	280-282	3	9
β-strand	288-293	6	9
β-strand	296	1	9
β-strand	297-301	5	8
α-helix	303-307	5
α-helix	308-310	3
β-strand	322-331	10	9
β-strand	337-347	11	9
β-strand	353-356	4	10
β-strand	362-363	2	11
β-strand	369-376	8	10
β-strand	382	1	10
β-strand	387-396	10	11
β-strand	401-403	3	11
α-helix	404-406	3
β-strand	407-410	4	11
β-strand	417-422	6	10
β-strand	428-437	10	11
β-strand	449-456	8	11
α-helix	457-458	2
β-strand	464-469	6	12
α-helix	475	1
β-strand	476	1	13
α-helix	477	1
β-strand	481-489	9	12
α-helix	493-495	3
β-strand	498-505	8	14
β-strand	508-516	9	14
β-strand	524-529	6	12
α-helix	530	1
α-helix	532-534	3
β-strand	537-546	10	14
β-strand	553-562	10	14
β-strand	563	1	13
β-strand	572-575	4	15
β-strand	582	1	16
β-strand	587-593	7	15
β-strand	599-606	8	17
α-helix	609-612	4
α-helix	619-621	3
α-helix	623-627	5
α-helix	628-630	3
β-strand	637	1	14
α-helix	642-648	7
β-strand	651-655	5	1

Chain B: 18 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	24-28	5	64
β-strand	31-32	2	65
β-strand	37-42	6	64
β-strand	50-58	9	66
β-strand	65-73	9	66
α-helix	75-77	3
β-strand	80-85	6	64
α-helix	98-99	2
β-strand	101-108	8	66
β-strand	112-118	7	66
β-strand	119-120	2	65
β-strand	125-130	6	67
β-strand	134-135	2	68
β-strand	140-141	2	69
β-strand	143-148	6	67
β-strand	154	1	67
β-strand	159-164	6	68
β-strand	170-176	7	68
β-strand	182-184	3	67
α-helix	185-187	3
β-strand	188-189	2	69
α-helix	190-191	2
β-strand	197-205	9	68
β-strand	212-219	8	68
β-strand	221-222	2	70
β-strand	228-233	6	71
β-strand	237-238	2	72
β-strand	246-255	10	71
β-strand	258-259	2	71
β-strand	262-272	11	72
β-strand	281-282	2	72
β-strand	288-293	6	72
β-strand	296	1	72
β-strand	297-301	5	71
α-helix	303-307	5
α-helix	308-310	3
β-strand	322-331	10	72
β-strand	337-347	11	72
β-strand	352-356	5	73
β-strand	362-363	2	74
β-strand	369-377	9	73
β-strand	382	1	73
β-strand	387-396	10	74
β-strand	401-403	3	74
α-helix	404-406	3
β-strand	407-410	4	74
β-strand	417-422	6	73
β-strand	428-437	10	74
β-strand	449-456	8	74
α-helix	457-458	2
β-strand	464-469	6	75
α-helix	475	1
β-strand	476	1	76
α-helix	477	1
β-strand	481-489	9	75
β-strand	498-505	8	77
β-strand	508-516	9	77
β-strand	524-529	6	75
α-helix	530	1
α-helix	532-534	3
β-strand	537-546	10	77
β-strand	553-562	10	77
β-strand	563	1	76
α-helix	564	1
β-strand	572-575	4	78
β-strand	582	1	79
β-strand	587-593	7	78
β-strand	599-606	8	80
α-helix	609-612	4
α-helix	619-621	3
α-helix	623-627	5
α-helix	628-630	3
β-strand	637	1	77
α-helix	642-648	7
β-strand	651-655	5	64

Chain C: 38 helices, 60 β-strands

Element	Residues	Length	Sheet
α-helix	680-683	4
α-helix	684-690	7
α-helix	694-703	10
α-helix	711-716	6
α-helix	722-737	16
α-helix	744-753	10
α-helix	754-756	3
β-strand	764-765	2	7
α-helix	770-772	3
β-strand	773-779	7	17
β-strand	783-789	7	15
α-helix	790-791	2
β-strand	796-804	9	17
β-strand	809-811	3	17
α-helix	812-814	3
β-strand	815-818	4	17
β-strand	819	1	16
β-strand	823-828	6	18
β-strand	832-834	3	19
β-strand	838-847	10	18
β-strand	853-859	7	19
β-strand	862	1	18
β-strand	865-867	3	18
α-helix	870-871	2
β-strand	872-873	2	20
β-strand	879-880	2	20
α-helix	881-883	3
β-strand	886-888	3	19
β-strand	892-902	11	18
β-strand	906-916	11	19
β-strand	919-930	12	19
β-strand	934-944	11	21
β-strand	945	1	22
β-strand	954	1	22
β-strand	957-959	3	23
β-strand	967	1	21
α-helix	968	1
β-strand	974-981	8	21
α-helix	985-988	4
α-helix	989-993	5
α-helix	1008-1028	21
α-helix	1031-1033	3
α-helix	1038-1056	19
α-helix	1057-1059	3
β-strand	1060	1	24
β-strand	1066	1	24
β-strand	1067	1	25
β-strand	1074	1	25
α-helix	1076-1089	14
α-helix	1097-1109	13
β-strand	1112	1	26
β-strand	1118	1	26
β-strand	1130	1	27
α-helix	1133-1154	22
α-helix	1162-1178	17
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1217-1219	3	28
β-strand	1225-1227	3	28
α-helix	1245-1260	16
α-helix	1268-1277	10
α-helix	1278-1279	2
α-helix	1288-1303	16
α-helix	1305-1309	5
β-strand	1310	1	29
β-strand	1313-1317	5	23
β-strand	1322	1	23
α-helix	1324-1325	2
β-strand	1326	1	23
α-helix	1335-1337	3
β-strand	1338-1340	3	21
β-strand	1346-1350	5	23
β-strand	1354	1	29
β-strand	1357-1367	11	21
β-strand	1377-1385	9	30
β-strand	1400-1408	9	30
β-strand	1414	1	27
β-strand	1422-1427	6	31
α-helix	1428-1429	2
β-strand	1432-1434	3	30
α-helix	1436-1443	8
β-strand	1452-1456	5	31
β-strand	1459-1464	6	31
β-strand	1473-1481	9	30
β-strand	1485-1486	2	18
α-helix	1488-1490	3
β-strand	1491-1497	7	31
β-strand	1504-1509	6	31
α-helix	1526-1528	3
α-helix	1545-1552	8
β-strand	1559-1571	13	32
β-strand	1574-1584	11	32
β-strand	1597-1603	7	32
β-strand	1616-1621	6	32
β-strand	1625-1628	4	32
β-strand	1633-1638	6	32
β-strand	1644-1645	2	32
α-helix	1658-1673	16

Chain D: 36 helices, 58 β-strands

Element	Residues	Length	Sheet
α-helix	681-688	8
α-helix	694-703	10
α-helix	711-716	6
α-helix	722-737	16
α-helix	744-754	11
β-strand	764-765	2	70
α-helix	770-772	3
β-strand	773	1	80
β-strand	777-779	3	80
β-strand	783-789	7	78
α-helix	790-791	2
β-strand	796-805	10	80
β-strand	808-811	4	80
α-helix	812-814	3
β-strand	815-818	4	80
β-strand	819	1	79
β-strand	823-828	6	81
β-strand	832-834	3	82
β-strand	838-847	10	81
β-strand	853-859	7	82
β-strand	865-867	3	81
α-helix	870-871	2
β-strand	872-873	2	83
β-strand	879-880	2	83
α-helix	881-883	3
β-strand	886-888	3	82
β-strand	892-902	11	81
β-strand	906-916	11	82
β-strand	919-930	12	82
β-strand	934-944	11	84
β-strand	945	1	85
β-strand	954	1	85
β-strand	957-959	3	86
β-strand	967	1	84
α-helix	968	1
β-strand	974-981	8	84
α-helix	985-988	4
α-helix	989-993	5
α-helix	1008-1028	21
α-helix	1031-1033	3
α-helix	1038-1056	19
α-helix	1057-1059	3
β-strand	1060	1	87
β-strand	1066	1	87
β-strand	1067	1	88
β-strand	1074	1	88
α-helix	1076-1089	14
α-helix	1097-1109	13
β-strand	1112	1	89
β-strand	1118	1	89
α-helix	1133-1154	22
α-helix	1162-1178	17
α-helix	1185-1196	12
α-helix	1203-1214	12
β-strand	1217-1219	3	90
β-strand	1225-1227	3	90
α-helix	1245-1260	16
α-helix	1264-1266	3
α-helix	1268-1277	10
α-helix	1278-1279	2
α-helix	1288-1303	16
α-helix	1305-1309	5
β-strand	1310	1	91
β-strand	1313-1317	5	86
β-strand	1322	1	86
α-helix	1324-1325	2
β-strand	1326	1	86
α-helix	1335-1337	3
β-strand	1338-1340	3	84
β-strand	1346-1350	5	86
β-strand	1354	1	91
β-strand	1357-1367	11	84
β-strand	1377-1386	10	92
β-strand	1399-1408	10	92
β-strand	1422-1427	6	93
β-strand	1432-1434	3	92
α-helix	1436-1443	8
β-strand	1452-1456	5	93
β-strand	1459-1464	6	93
β-strand	1473-1481	9	92
β-strand	1485-1486	2	81
α-helix	1488-1490	3
β-strand	1491-1497	7	93
β-strand	1504-1509	6	93
α-helix	1526-1528	3
α-helix	1545-1552	8
β-strand	1559-1571	13	94
β-strand	1574-1584	11	94
β-strand	1597-1603	7	94
β-strand	1616-1621	6	94
β-strand	1625-1628	4	94
β-strand	1633-1638	6	94
β-strand	1644-1645	2	94
α-helix	1658-1673	16

Chain J: 16 helices, 58 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	33
β-strand	32-34	3	34
β-strand	35	1	35
β-strand	39-40	2	36
β-strand	42-46	5	33
β-strand	52-60	9	34
β-strand	67-75	9	34
β-strand	82-83	2	33
β-strand	86-87	2	36
β-strand	89	1	35
β-strand	103-110	8	34
β-strand	113-122	10	34
β-strand	128-132	5	37
β-strand	136-137	2	38
β-strand	142-143	2	39
β-strand	145-149	5	37
β-strand	161-166	6	38
β-strand	172-178	7	38
α-helix	184-185	2
β-strand	186-187	2	39
β-strand	195-203	9	38
β-strand	210-216	7	38
α-helix	219-222	4
β-strand	224-230	7	40
β-strand	234-236	3	41
α-helix	241-242	2
β-strand	243-251	9	40
β-strand	256	1	40
β-strand	259-268	10	41
β-strand	273-275	3	41
α-helix	277-279	3
β-strand	281-285	5	41
β-strand	286	1	42
β-strand	289	1	42
β-strand	290-294	5	40
α-helix	296-302	7
α-helix	306-309	4
β-strand	313-322	10	41
β-strand	328-339	12	41
β-strand	344-346	3	43
β-strand	353-354	2	44
α-helix	359	1
β-strand	360-367	8	43
β-strand	373	1	43
β-strand	378-381	4	44
β-strand	386-389	4	44
β-strand	395-400	6	43
β-strand	408-414	7	44
β-strand	427-434	8	44
β-strand	436	1	45
α-helix	438-440	3
β-strand	444-448	5	46
β-strand	454	1	47
β-strand	459-467	9	46
α-helix	470-473	4
β-strand	478-485	8	48
β-strand	488-496	9	48
β-strand	503-509	7	46
α-helix	512-514	3
β-strand	517-526	10	48
β-strand	530-539	10	48
β-strand	540	1	47
α-helix	541	1
β-strand	548-551	4	49
β-strand	556-557	2	50
β-strand	562-569	8	49
β-strand	574-581	8	51
α-helix	582-585	4
α-helix	589-591	3
α-helix	595-603	9
β-strand	616	1	45
α-helix	617-624	8
β-strand	626-629	4	33
α-helix	636-638	3

Chains K and N: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
α-helix	739-741	3
α-helix	746-747	2
β-strand	748	1	52
β-strand	754-761	8	51
β-strand	772-779	8	49
β-strand	787-795	9	51
β-strand	799-802	4	51
α-helix	803-805	3
β-strand	806-808	3	51
β-strand	809-810	2	50
β-strand	814-819	6	53
β-strand	824-825	2	52
β-strand	830-838	9	53
β-strand	844-850	7	52
α-helix	851-852	2
β-strand	856-857	2	54
β-strand	866-872	7	52
β-strand	876-884	9	53
β-strand	885-886	2	54
β-strand	890-900	11	52
β-strand	906-916	11	52
β-strand	920-930	11	55
β-strand	940-945	6	56
α-helix	946-948	3
β-strand	953	1	55
α-helix	954	1
β-strand	959-967	9	55

Chain L: 6 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	1274-1280	7	56
β-strand	1288-1292	5	56
β-strand	1301-1305	5	55
β-strand	1311-1318	8	56
β-strand	1321-1331	11	55
β-strand	1343-1351	9	57
β-strand	1363-1371	9	57
β-strand	1377	1	58
β-strand	1380-1385	6	59
β-strand	1390-1392	3	57
β-strand	1393	1	60
α-helix	1394-1402	9
β-strand	1406-1408	3	59
β-strand	1413-1414	2	60
β-strand	1417-1418	2	60
β-strand	1422-1427	6	59
β-strand	1430	1	58
β-strand	1436-1444	9	57
β-strand	1454	1	61
β-strand	1455-1460	6	59
β-strand	1468-1469	2	59
β-strand	1472	1	61
α-helix	1480-1482	3
β-strand	1483-1486	4	62
β-strand	1489-1492	4	62
α-helix	1508-1515	8
β-strand	1520-1534	15	63
β-strand	1537-1549	13	63
β-strand	1561-1566	6	63
α-helix	1567-1569	3
α-helix	1570-1573	4
β-strand	1580-1586	7	63
β-strand	1590-1591	2	63
β-strand	1597-1600	4	63
β-strand	1606-1610	5	63
α-helix	1624-1637	14

Chain M: 18 helices, 57 β-strands

Element	Residues	Length	Sheet
β-strand	24-30	7	95
β-strand	32-34	3	96
β-strand	35	1	97
β-strand	38-40	3	98
β-strand	42-46	5	95
β-strand	52-60	9	96
β-strand	67-75	9	96
β-strand	82-83	2	95
β-strand	86-88	3	98
β-strand	89	1	97
β-strand	103-109	7	96
β-strand	114-122	9	96
β-strand	127-132	6	99
β-strand	136-137	2	100
β-strand	142-143	2	101
β-strand	145-150	6	99
β-strand	161-166	6	100
β-strand	172-178	7	100
α-helix	184-185	2
β-strand	186-187	2	101
α-helix	188-189	2
β-strand	195-203	9	100
β-strand	210-216	7	100
β-strand	224-230	7	102
β-strand	234-235	2	103
α-helix	241-242	2
β-strand	243-251	9	102
β-strand	256	1	102
β-strand	259-268	10	103
β-strand	273-275	3	103
α-helix	277-279	3
β-strand	281-285	5	103
β-strand	290-294	5	102
α-helix	296-302	7
α-helix	306-309	4
β-strand	313-322	10	103
β-strand	328-338	11	103
β-strand	344-346	3	104
β-strand	353-354	2	105
α-helix	359	1
β-strand	360-367	8	104
β-strand	373	1	104
β-strand	378-379	2	106
β-strand	380	1	105
β-strand	388-389	2	106
β-strand	395-400	6	104
β-strand	408-414	7	105
β-strand	427-434	8	105
β-strand	436	1	107
α-helix	438-440	3
β-strand	444-448	5	108
β-strand	454	1	109
β-strand	459-467	9	108
α-helix	470-473	4
β-strand	478-485	8	110
β-strand	488-496	9	110
β-strand	503-509	7	108
α-helix	512-514	3
β-strand	517-526	10	110
β-strand	530-539	10	110
β-strand	540	1	109
α-helix	541	1
β-strand	548-551	4	111
β-strand	556-557	2	112
β-strand	562-569	8	111
β-strand	574-581	8	113
α-helix	582-585	4
α-helix	589-591	3
α-helix	595-602	8
α-helix	603-605	3
β-strand	616	1	107
α-helix	617-624	8
β-strand	626-629	4	95
α-helix	636-638	3
α-helix	644-647	4

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5 beta chain	A, B	protein	655	Homo sapiens	P01031 (AlphaFold model)
Complement C5 alpha chain	C, D	protein	999	Homo sapiens	P01031 (AlphaFold model)
Cobra venom factor alpha chain	J, M	protein	627	Naja kaouthia	Q91132 (AlphaFold model)
Cobra venom factor gamma chain	K, N	protein	252	Naja kaouthia	Q91132 (AlphaFold model)
Cobra venom factor beta chain	L, O	protein	379	Naja kaouthia	Q91132 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>9TDL_1 Complement C5 beta chain (chains A, B)
QEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYPDKKFSYSSGHVHLSSENK
FQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPITYDNGFLFIHTDKPVYTPD
QSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHIGIISFPDFKIPSNPRYGM
WTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGYKNFKNFEITIKARYFYNK
VVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVTFDSETAVKELSYYSLEDL
NNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATPLFLKPGIPYPIKVQVKDS
LDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASFVLNLPSGVTVLEFNVKTD
APDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGEHLNIIVTPKSPYIDKITH
YNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRLLVYYIVTGEQTAELVSDS
VWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWVALAAVDSAVYGVQRGAKK
PLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANADDSQENDEPCKEIL

Sequence of entity 2 (C, D), FASTA

>9TDL_2 Complement C5 alpha chain (chains C, D)
TLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISLGPRCIKAFTECCVVASQ
LRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLVPRRKQLQFALPDSLTTW
EIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQLKGTVYNYRTSGMQFCV
KMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTVLPLEIGLHNINFSLETW
FGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFPYRIPLDLVPKTEIKRIL
SVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFYVFHYLETGNHWNIFHSD
PLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTAFALRVLGQVNKYVEQNQ
NSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEARENSLYLTAFTVIGIRKAFD
ICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDKTHPQFRSIVSALKREAL
VKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLNLKDINYVNPVIKWLSEE
QRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHKGALHNYKMTDKNFLGRP
VEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLKIDTQDIEASHYRGYGNS
DYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLKALVEGVDQLFTDYQIKD
GHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHRPDKQCTMFYSTSNIKIQ
KVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYAYKVSITSITVENVFVKY
KATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIMGKEALQIKYNFSFRYIY
PLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 3 (J, M), FASTA

>9TDL_3 Cobra venom factor alpha chain (chains J, M)
ALYTLITPAVLRTDTEEQILVEAHGDSTPKQLDIFVHDFPRKQKTLFQTRVDMNPAGGML
VTPTIEIPAKEVSTDSRQNQYVVVQVTGPQVRLEKVVLLSYQSSFLFIQTDKGIYTPGSP
VLYRVFSMDHNTSKMNKTVIVEFQTPEGILVSSNSVDLNFFWPYNLPDLVSLGTWRIVAK
YEHSPENYTAYFDVRKYVLPSFEVRLQPSEKFFYIDGNENFHVSITARYLYGEEVEGVAF
VLFGVKIDDAKKSIPDSLTRIPIIDGDGKATLKRDTFRSRFPNLNELVGHTLYASVTVMT
ESGSDMVVTEQSGIHIVASPYQIHFTKTPKYFKPGMPYELTVYVTNPDGSPAAHVPVVSE
AFHSMGTTLSDGTAKLILNIPLNAQSLPITVRTNHGDLPRERQATKSMTAIAYQTQGGSG
NYLHVAITSTEIKPGDNLPVNFNVKGNANSLKQIKYFTYLILNKGKIFKVGRQPRRDGQN
LVTMNLHITPDLIPSFRFVAYYQVGNNEIVADSVWVDVKDTCMGTLVVKGDNLIQMPGAA
MKIKLEGDPGARVGLVAVDKAVYVLNDKYKISQAKIWDTIEKSDFGCTAGSGQNNLGVFE
DAGLALTTSTNLNTKQRSAAKCPQPAN

Sequence of entity 4 (K, N), FASTA

>9TDL_4 Cobra venom factor gamma chain (chains K, N)
DDNEDGFIADSDIISRSDFPKSWLWLTKDLTEEPNSQGISSKTMSFYLRDSITTWVVLAV
SFTPTKGICVAEPYEIRVMKVFFIDLQMPYSVVKNEQVEIRAILHNYVNEDIYVRVELLY
NPAFCSASTKGQRYRQQFPIKALSSRAVPFVIVPLEQGLHDVEIKASVQEALWSDGVRKK
LKVVPEGVQKSIVTIVKLDPRAKGVGGTQLEVIKARKLDDRVPDTEIETKIIIQGDPVAQ
IIENSIDGSKLN

Sequence of entity 5 (L, O), FASTA

>9TDL_5 Cobra venom factor beta chain (chains L, O)
EIQMPTHKDLNLDITIELPDREVPIRYRINYENALLARTVETKLNQDITVTASGDGKATM
TILTFYNAQLQEKANVCNKFHLNVSVENIHLNAMGAKGALMLKICTRYLGEVDSTMTIID
ISMLTGFLPDAEDLTRLSKGVDRYISRYEVDNNMAQKVAVIIYLNKVSHSEDECLHFKIL
KHFEVGFIQPGSVKVYSYYNLDEKCTKFYHPDKGTGLLNKICIGNVCRCAGETCSSLNHQ
ERIDVPLQIEKACETNVDYVYKTKLLRIEEQDGNDIYVMDVLEVIKQGTDENPRAKTHQY
ISQRKCQEALNLKVNDDYLIWGSRSDLLPTKDKISYIITKNTWIERWPHEDECQEEEFQK
LCDDFAQFSYTLTEFGCPT

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Substrate recognition by complement convertases revealed in the C5-cobra venom factor complex. Laursen, N.S., Andersen, K.R., Braren, I. et al. EMBO J (2011) 30:606-616. DOI 10.1038/emboj.2010.341 · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 9TDL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.