PDGFRA-G680R mutant kinase domain in complex with a 7-methoxyquinazolin-6-ol-based compound (45). Determined by X-ray diffraction at 2.3 Å resolution. Released 15 Jul 2026.
Explore 9TFC in 3D Show helices and sheets RCSB PDB PDBe
9TFC contains 21 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 577-579 | 3 | |
| α-helix | 581-582 | 2 | |
| α-helix | 584-586 | 3 | |
| β-strand | 587 | 1 | 1 |
| α-helix | 590-592 | 3 | |
| β-strand | 593-601 | 9 | 1 |
| β-strand | 605-613 | 9 | 1 |
| β-strand | 621-629 | 9 | 1 |
| α-helix | 635-651 | 17 | |
| β-strand | 657 | 1 | 2 |
| β-strand | 660-664 | 5 | 1 |
| β-strand | 671-675 | 5 | 1 |
| β-strand | 681 | 1 | 2 |
| α-helix | 682-688 | 7 | |
| α-helix | 690-694 | 5 | |
| α-helix | 792-811 | 20 | |
| β-strand | 814-815 | 2 | 3 |
| α-helix | 821-823 | 3 | |
| β-strand | 824-827 | 4 | 2 |
| β-strand | 831-834 | 4 | 2 |
| β-strand | 841-842 | 2 | 3 |
| α-helix | 845-848 | 4 | |
| α-helix | 859-861 | 3 | |
| α-helix | 864-869 | 6 | |
| α-helix | 874-889 | 16 | |
| α-helix | 893-894 | 2 | |
| α-helix | 903-911 | 9 | |
| α-helix | 915-918 | 4 | |
| α-helix | 923-932 | 10 | |
| α-helix | 937-939 | 3 | |
| α-helix | 941-942 | 2 | |
| α-helix | 943-952 | 10 | |
| α-helix | 956-970 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Platelet-derived growth factor receptor alpha | A | protein | 355 | Homo sapiens | P16234 (AlphaFold model) |
>9TFC_1 Platelet-derived growth factor receptor alpha (chains A) GGRKQKPRYEIRWRVIESISPDGHEYIYVDPMQLPYDSRWEFPRDGLVLGRVLGSGAFGK VVEGTAYGLSRSQPVMKVAVKMLKPTARSSEKQALMSELKIMTHLGPHLNIVNLLGACTK SGPIYIITEYCFYRDLVNYLHKNRDSFLSHKKKSMLDSEVKNLLSDDNSEGLTLLDLLSF TYQVARGMEFLASKNCVHRDLAARNVLLAQGKIVKICDFGLARDIMHDSNYVSKGSTFLP VKWMAPESIFDNLYTTLSDVWSYGILLWEIFSLGGTPYPGMMVDSTFYNKIKSGYRMAKP DHATSEVYEIMVKCWNSEPEKRPSFYHLSEIVENLLPGQYKKSYEKIHLDFLKSD
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1JVR | 4-[4-[5-[(1~{S})-1-azanyl-1-(4-fluorophenyl)ethyl]pyrimidin-2-yl]piperazin-1-yl… | C25 H26 F N7 O2 | 1 |
Structure-based scaffold hopping reveals strategies to overcome oncogenic KIT and PDGFRA mutation-driven drug-resistance in GIST. Schulz, T., Beerbaum, M., Scrima, A. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-76340-7 · PubMed
Other PDB entries of the same protein (UniProt P16234 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9TFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.