9TP9: Integrin-linked kinase

Crystal structure of integrin-linked kinase (ILK) in complex with Alpha-Parvin and dihydroPelitinib. Determined by X-ray diffraction at 1.45 Å resolution. Released 3 Jun 2026.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,456
Mol. weight: 46.51 kDa
Ligands: A1JW8
Released: 3 Jun 2026

Explore 9TP9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TP9 contains 31 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	190-192	3
β-strand	194-202	9	1
β-strand	205-212	8	1
β-strand	215-222	8	1
α-helix	223	1
α-helix	229-238	10
α-helix	240-242	3
β-strand	250-251	2	2
β-strand	253-257	5	1
β-strand	266-270	5	1
α-helix	271-272	2
β-strand	276	1	2
α-helix	277-282	6
α-helix	291-309	19
α-helix	314-315	2
α-helix	318-320	3
α-helix	322-324	3
β-strand	325-327	3	2
β-strand	333-336	4	2
α-helix	337-339	3
α-helix	340-342	3
β-strand	350	1	3
α-helix	353-355	3
α-helix	358-362	5
α-helix	365-367	3
α-helix	370-387	18
α-helix	397-406	10
α-helix	411-414	4
α-helix	419-428	10
α-helix	433-435	3
α-helix	437-438	2
α-helix	439-448	10

Chain B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	251-254	4
α-helix	259-276	18
α-helix	277-279	3
α-helix	294-304	11
β-strand	307	1	3
α-helix	310-312	3
α-helix	320-336	17
α-helix	339-342	4
α-helix	346-350	5
α-helix	354-368	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Scaffold protein ILK	A	protein	271	Homo sapiens	Q13418 (AlphaFold model)
Alpha-parvin	B	protein	127	Homo sapiens	Q9NVD7 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TP9_1 Scaffold protein ILK (chains A)
MNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWSTRKSRDFNEECPR
LRIFSHPNVLPVLGACQSPPAPHPTLITHWMPYGSLYNVLHEGTNFVVDQSQAVKFALDM
ARGMAFLHTLEPLIPRHALNSRSVMIDEDMTARISMADVKFSFQSPGRMYAPAWVAPEAL
QKKPEDTNRRSADMWSFAVLLWELVTREVPFADLSNMEIGMKVALEGLRPTIPPGISPHV
SKLMKICMNEDPAKRPKFDMIVPILEKMQDK

Sequence of entity 2 (B), FASTA

>9TP9_2 Alpha-parvin (chains B)
SMDAFDTLFDHAPDKLNVVKKTLITFVNKHLNKLNLEVTELETQFADGVYLVLLMGLLEG
YFVPLHSFFLTPDSFEQKVLNVSFAFELMQDGGLEKPKPRPEDIVNCDLKSTLRVLYNLF
TKYRNVE

Ligands and cofactors

ID	Name	Formula	Copies
A1JW8	~{N}-[4-[(3-chloranyl-4-fluoranyl-phenyl)amino]-3-cyano-7-ethoxy-quinolin-6-yl]…	C24 H25 Cl F N5 O2	1

Water and common crystallization additives (EDO, EPE) are not listed.

Primary citation

Identification and Validation of 3-Cyano-Quinoline Ligands Targeting Integrin-Linked Kinase (ILK). Greco, F.A., Abdul Azeez, K.R., Mitrovic, M. et al. J Med Chem (2026) 69:12982-13001. DOI 10.1021/acs.jmedchem.5c03773 · PubMed

Other PDB entries of the same protein (UniProt Q13418 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4HI8 1.2 Å, Structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1…
4HI9 1.2 Å, 1.2 structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
9D5E 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to gefitinib
9D5F 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to bosutinib
9D5H 1.5 Å, Crystal structure of the ILK mutant (R371Q)/alpha-parvin core complex bound to gefitinib
9D5I 1.5 Å, Crystal structure of the ILK mutant (R225A)/alpha-parvin core complex bound to MgATP
9D5P 1.5 Å, Crystal structure of the ILK/alpha-parvin core complex bound to erlotinib
9TPD 1.5 Å, Crystal structure of integrin-linked kinase (ILK) in complex with alpha-parvin and a…
9D5G 1.55 Å, Crystal structure of the ILK/alpha-parvin core complex bound to 4-methyl erlotinib
3F6Q 1.6 Å, Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1…
3KMU 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (apo)
3REP 1.8 Å, Crystal structure of the ILK/alpha-parvin core complex (MnATP)

Browse structure collections

About this viewer

MolViewer shows 9TP9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.