9U8G: TMPRSS2

Crystal structure of TMPRSS2 in complex with nanobody77_10. Determined by X-ray diffraction at 2.0 Å resolution. Released 30 Jul 2025.

Method: X-ray diffraction
Resolution: 2.0 Å
Organisms: Homo sapiens, Vicugna pacos
Chains: 6
Atoms: 8,240
Mol. weight: 118.3 kDa
Ligands: CA, NAG
Released: 30 Jul 2025

Explore 9U8G in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9U8G contains 32 α-helices and 82 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	118-119	2	1
β-strand	125-127	3	1
α-helix	129-131	3
α-helix	143-145	3
β-strand	149-152	4	2
β-strand	157-162	6	2
β-strand	167-170	4	2
β-strand	171	1	3
β-strand	172	1	2
α-helix	178-187	10
β-strand	196-200	5	2
β-strand	209-212	4	3
α-helix	221-223	3
β-strand	225-228	4	3
β-strand	236-240	5	2

Chains B and D: 9 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	257	1	4
β-strand	260-261	2	5
α-helix	262-263	2
β-strand	270-275	6	6
β-strand	278-285	8	6
β-strand	290-293	4	6
α-helix	295-297	3
α-helix	305-307	3
β-strand	308-312	5	6
β-strand	316	1	7
α-helix	317-319	3
β-strand	326-333	8	6
β-strand	338	1	8
β-strand	343	1	8
β-strand	347-351	5	6
α-helix	363-364	2
β-strand	365	1	5
α-helix	366-368	3
β-strand	378-383	6	5
α-helix	391-394	4
β-strand	396	1	7
β-strand	398-405	8	5
α-helix	407-410	4
β-strand	424-428	5	5
β-strand	435	1	4
β-strand	444-449	6	5
β-strand	452-461	10	5
β-strand	472-476	5	5
α-helix	477-492	16

Chains E and F: 3 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	17
β-strand	10-12	3	9
β-strand	18-25	8	17
α-helix	28-30	3
β-strand	33-39	7	9
β-strand	46-52	7	9
β-strand	57-60	4	9
β-strand	68-73	6	17
β-strand	78-83	6	17
α-helix	88-90	3
β-strand	92-97	6	9
α-helix	99-102	4
β-strand	117-121	5	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transmembrane protease serine 2 non-catalytic chain	A, C	protein	146	Homo sapiens	O15393 (AlphaFold model)
Transmembrane protease serine 2 catalytic chain	B, D	protein	249	Homo sapiens	O15393 (AlphaFold model)
Nanobody	E, F	protein	131	Vicugna pacos

Sequence of entity 1 (A, C), FASTA

>9U8G_1 Transmembrane protease serine 2 non-catalytic chain (chains A, C)
MGSKCSNSGIECDSSGTCINPSNWCDGVSHCPGGEDENRCVRLYGPNFILQVYSSQRKSW
HPVCQDDWNENYGRAACRDMGYKNNFYSSQGIVDDSGSTSFMKLNTSAGNVDIYKKLYHS
DACSSKAVVSLRCIACGVNLNDDDDK

Sequence of entity 2 (B, D), FASTA

>9U8G_2 Transmembrane protease serine 2 catalytic chain (chains B, D)
IVGGESALPGAWPWQVSLHVQNVHVCGGSIITPEWIVTAAHCVEKPLNNPWHWTAFAGIL
RQSFMFYGAGYQVEKVISHPNYDSKTKNNDIALMKLQKPLTFNDLVKPVCLPNPGMMLQP
EQLCWISGWGATEEKGKTSEVLNAAKVLLIETQRCNSRYVYDNLITPAMICAGFLQGNVD
SCQGDSGGPLVTSKNNIWWLIGDTSWGSGCAKAYRPGVYGNVMVFTDWIYRQMRADGEFV
EHHHHHHHH

Sequence of entity 3 (E, F), FASTA

>9U8G_3 Nanobody (chains E, F)
AVQLQASGGGFVQPGGSLRLSCAASGKVVEQGLMGWFRQAPGKEREFVSAIQYDTKLEYY
ADSVKGRFTISRDNSKNTVYLQMNSLRAEDTATYYCATPQMWVQRDRDDRWYWGQGTQVT
VSSGSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Water and common crystallization additives (GOL) are not listed.

Primary citation

The crystal structure of coronavirus RBD-TMPRSS2 complex provides basis for the discovery of therapeutic antibodies. Zhao, Z., Yang, Q., Liu, X. et al. Nat Commun (2025) 16:6636-6636. DOI 10.1038/s41467-025-62023-2 · PubMed

Other PDB entries of the same protein (UniProt O15393 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8V04 1.58 Å, High resolution TMPRSS2 structure following acylation by nafamostat
8S0L 1.8 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
9JD1 1.9 Å, Crystal structure of TMPRSS2 in complex with Fab
7MEQ 1.95 Å, Crystal structure of human TMPRSS2 in complex with Nafamostat
9JD0 2.0 Å, Crystal structure of TMPRSS2 in complex with nanobody
9E83 2.07 Å, TMPRSS2 crystal structure following acylation by UCSF_157
8V1F 2.19 Å, TMPRSS2 complexed with the noncovalent inhibitor 6-amidino-2-napthol
8S0N 2.3 Å, Crystal structure of the TMPRSS2 zymogen in complex with the nanobody A07
7Y0E 2.39 Å, Crystal structure of TMPRSS2 in complex with Camostat
8HD8 2.4 Å, Crystal structure of TMPRSS2 in complex with 212-148
9IZN 2.4 Å, Crystal structure of HKU1A RBD bound to TMPRSS2
7XYD 2.58 Å, Crystal structure of TMPRSS2 in complex with Nafamostat

Browse structure collections

About this viewer

MolViewer shows 9U8G directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.