9U9X: SR-related and CTD-associated factor 8

1H, 13C, and 15N resonance assignments and solution structure of the CID domain of SCAF8 (RBM16). Determined by solution NMR. Released 1 Apr 2026.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,201
Mol. weight: 17.08 kDa
Released: 1 Apr 2026

Explore 9U9X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9U9X contains 13 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 0 β-strands

Element	Residues	Length
α-helix	11-21	11
α-helix	22-25	4
α-helix	27	1
α-helix	30-31	2
α-helix	32-44	13
α-helix	45-48	4
α-helix	49-62	14
α-helix	65-67	3
α-helix	68-85	18
α-helix	94-97	4
α-helix	101-108	8
α-helix	116-128	13
α-helix	134-145	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SR-related and CTD-associated factor 8	A	protein	152	Homo sapiens	Q9UPN6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9U9X_1 SR-related and CTD-associated factor 8 (chains A)
GSSGSSGDNMEAVKTFNSELYSLNDYKPPISKAKMTQITKAAIKAIKFYKHVVQSVEKFI
QKCKPEYKVPGLYVIDSIVRQSRHQFGQEKDVFAPRFSNNIISTFQNLYRCPGDDKSKIV
RVLNLWQKNNVFKSEIIQPLLDMAAGSGPSSG

Primary citation

1H, 13C, and 15N resonance assignments and solution structure of the CID domain of SCAF8 (RBM16). Kuwasako, K., Dang, W., He, F. et al. To be published.

Other PDB entries of the same protein (UniProt Q9UPN6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9J 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9N 1.6 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9M 1.75 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9I 1.91 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9O 2.0 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9P 2.1 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9K 2.2 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
3D9L 2.2 Å, Snapshots of the RNA processing factor SCAF8 bound to different phosphorylated forms of…
2DIW Solution structure of the RPR domain of Putative RNA-binding protein 16

Browse structure collections

About this viewer

MolViewer shows 9U9X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.