9UAP: PDB entry 9UAP

cryo-EM structure of ligand-free active-state M1 muscarinic acetylcholine receptor with alpha5 helix of G11 protein complex. Determined by electron microscopy at 3.62 Å resolution. Released 29 Oct 2025.

Method: Electron microscopy
Resolution: 3.62 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,718
Mol. weight: 45.22 kDa
Released: 29 Oct 2025

Explore 9UAP in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UAP contains 21 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 0 β-strands

Element	Residues	Length
α-helix	26-49	24
α-helix	59-61	3
α-helix	62-77	16
α-helix	79-87	9
α-helix	94-128	35
α-helix	130-135	6
α-helix	140-167	28
α-helix	181-183	3
α-helix	189-193	5
α-helix	194-198	5
α-helix	200-231	32
α-helix	234-246	13
α-helix	252-272	21
α-helix	278-287	10
α-helix	296-310	15
α-helix	313-337	25
α-helix	339-348	10
α-helix	357-378	22
α-helix	380-382	3
α-helix	384-394	11

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	334-355	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
M1 muscarinic acetylcholine receptor, de novo design protein	A	protein	372	Homo sapiens
Guanine nucleotide-binding protein subunit alpha-11	B	protein	27	Homo sapiens	P29992 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UAP_1 M1 muscarinic acetylcholine receptor, de novo design protein (chains A)
VAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVNNYFLLSLACADLIIGTFSMNLYTT
YLLMGHWALGTLACDLWLALDYVASNASVMNLLLISFDRYFSVTRPLSYRAKRTPRRAAL
MIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYIQFLSQPIITFGTAMAAFYLPVTVM
CTLYWRIYRETKRAGERLAKLLEKFEALPLEDIVAALKALLATNRPEIQLAVKTIVENFP
EIKKEAEKLTPEQKAKLAALEAQLADLPEELRKVLLSMYLTGLLYGGSEENRKRAIEKAA
RTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYALCNKA
FRDTFRLLLLCR

Sequence of entity 2 (B), FASTA

>9UAP_2 Guanine nucleotide-binding protein subunit alpha-11 (chains B)
TPENIRFVFAAVKDTILQLNLKEYNLV

Primary citation

Extracellular nanobody screening using conformationally stable GPCR variants. Zhang, X., Gao, K., Nie, J. et al. Proc Natl Acad Sci U S A (2025) 122:e2508879122-e2508879122. DOI 10.1073/pnas.2508879122 · PubMed

Other PDB entries of the same protein (UniProt P29992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8QEH 1.43 Å, Crystal structure of the G11 protein heterotrimer bound to FR900359 inhibitor
8QEG 1.7 Å, Crystal structure of the G11 protein heterotrimer bound to YM-254890 inhibitor
9P87 2.8 Å, NTSR1-G11-NTS(8-13) Complex in the Canonical, AHD Partially Closed State (C-P-Closed-Apo)
9UCP 2.88 Å, cryo-EM structure of M1 muscarinic acetylcholine receptor-alpha5 helix of G11 protein…
7XXH 2.9 Å, Cryo-EM structure of the purinergic receptor P2Y1R in complex with 2MeSADP and G11
9P86 2.9 Å, NTSR1-G11-NTS(8-13) Complex in the Canonical, AHD Open State (C-Open-Apo)
9P88 2.9 Å, NTSR1-G11-NTS(8-13) Complex in the Non-Canonical, AHD Open State (NC-Open-Apo)
6OIJ 3.3 Å, Muscarinic acetylcholine receptor 1-G11 protein complex
7TRY 3.7 Å, Cryo-EM structure of corticotropin releasing factor receptor 2 bound to Urocortin 1 and…
9P8A 3.7 Å, NTSR1-G11-NTS(8-13) GTP-Bound Complex in the Canonical, AHD Closed State 3DVA Separated…
9P89 3.9 Å, NTSR1-G11-NTS(8-13) GTP-Bound Complex in the Canonical, AHD Closed State 3DVA Separated…
7RKF 4.0 Å, Structure of CX3CL1-US28-G11iN18-scFv16 in TL-state

Browse structure collections

About this viewer

MolViewer shows 9UAP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.