9UAX: Myanmar_N2 and AS4C_Fab complex

The structure of Myanmar_N2 and AS4C_Fab complex. Determined by electron microscopy at 2.71 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 2.71 Å
Organisms: Homo sapiens, Influenza A virus (A/California/VRDL364/2009(mixed))
Chains: 12
Atoms: 25,616
Mol. weight: 416.88 kDa
Ligands: CA, NAG
Released: 8 Apr 2026

Explore 9UAX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UAX contains 63 α-helices and 283 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-12	3	2
β-strand	17-25	9	1
α-helix	29-31	3
β-strand	34-39	6	2
β-strand	45-51	7	2
β-strand	58-60	3	2
α-helix	62-64	3
β-strand	68-73	6	1
β-strand	78-84	7	1
α-helix	88-90	3
β-strand	92-99	8	2
β-strand	110-112	3	2
β-strand	117-121	5	2
β-strand	127	1	3
β-strand	130-134	5	4
β-strand	146-155	10	4
β-strand	156	1	3
β-strand	161-164	4	5
β-strand	173-175	3	4
α-helix	176-178	3
β-strand	179-180	2	4
β-strand	186-194	9	4
β-strand	205-210	6	5
β-strand	215-220	6	5

Chain B: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	6
β-strand	10-13	4	7
β-strand	19-29	11	6
β-strand	33-38	6	7
β-strand	45-49	5	7
β-strand	53-54	2	7
α-helix	55	1
β-strand	62-75	14	6
β-strand	85-90	6	7
α-helix	96	1
β-strand	97-98	2	7
β-strand	102-106	5	7
β-strand	111	1	8
β-strand	114-118	5	9
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	9
β-strand	140	1	8
β-strand	145-150	6	10
β-strand	153-154	2	10
β-strand	159-163	5	9
α-helix	164-167	4
β-strand	173-182	10	9
α-helix	183-187	5
β-strand	191-197	7	10
β-strand	205-210	6	10

Chain C: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	11
β-strand	10-12	3	12
β-strand	17-25	9	11
α-helix	29-31	3
β-strand	34-39	6	12
β-strand	45-51	7	12
β-strand	58-60	3	12
β-strand	68-73	6	11
β-strand	78-84	7	11
α-helix	88-90	3
β-strand	92-99	8	12
β-strand	110-112	3	12
β-strand	117-121	5	12
β-strand	127	1	13
β-strand	130-134	5	14
α-helix	135-137	3
β-strand	145-155	11	14
β-strand	156	1	13
β-strand	161-164	4	15
α-helix	165-167	3
β-strand	174-175	2	14
α-helix	176-178	3
β-strand	179-180	2	14
β-strand	186-195	10	14
α-helix	196-198	3
β-strand	204-210	7	15
β-strand	215-221	7	15

Chain D: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	16
β-strand	10-13	4	17
β-strand	19-25	7	16
β-strand	33-38	6	17
β-strand	45-49	5	17
β-strand	53-54	2	17
α-helix	55	1
β-strand	62-67	6	16
β-strand	70-75	6	16
β-strand	85-90	6	17
α-helix	96	1
β-strand	97-98	2	17
β-strand	102-106	5	17
β-strand	111	1	18
β-strand	114-118	5	19
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	19
β-strand	140	1	18
β-strand	145-150	6	20
β-strand	154-155	2	20
β-strand	160-163	4	19
α-helix	164-167	4
β-strand	173-182	10	19
α-helix	183-187	5
β-strand	191-197	7	20
β-strand	205-210	6	20

Chain E: 3 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	21
β-strand	10-12	3	22
β-strand	17-25	9	21
α-helix	29-31	3
β-strand	34-39	6	22
β-strand	45-51	7	22
β-strand	58-60	3	22
β-strand	68-73	6	21
β-strand	78-84	7	21
α-helix	88-90	3
β-strand	92-99	8	22
β-strand	110-113	4	22
β-strand	117-121	5	22
β-strand	127	1	23
β-strand	130-134	5	24
β-strand	146-155	10	24
β-strand	156	1	23
β-strand	161-164	4	25
β-strand	173-175	3	24
α-helix	176-178	3
β-strand	179-180	2	24
β-strand	186-194	9	24
β-strand	199	1	26
β-strand	202	1	26
β-strand	204-210	7	25
β-strand	215-221	7	25

Chain F: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	27
β-strand	10-13	4	28
β-strand	19-25	7	27
β-strand	30	1	29
β-strand	33-38	6	28
β-strand	45-49	5	28
β-strand	53-54	2	28
α-helix	55	1
β-strand	62-67	6	27
β-strand	68	1	29
β-strand	70-75	6	27
β-strand	85-90	6	28
α-helix	96	1
β-strand	97-98	2	28
β-strand	102-106	5	28
β-strand	111	1	30
α-helix	112-113	2
β-strand	114-118	5	31
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	31
β-strand	140	1	30
β-strand	144-150	7	32
β-strand	153-155	3	32
β-strand	160-163	4	31
β-strand	173-182	10	31
α-helix	183-187	5
β-strand	191-198	8	32
β-strand	205-210	6	32

Chain G: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	33
β-strand	10-12	3	34
β-strand	17-25	9	33
α-helix	29-31	3
β-strand	34-39	6	34
β-strand	45-51	7	34
β-strand	58-60	3	34
β-strand	68-73	6	33
β-strand	78-84	7	33
α-helix	88-90	3
β-strand	92-99	8	34
β-strand	110-113	4	34
β-strand	117-121	5	34
β-strand	127	1	35
β-strand	130-134	5	36
β-strand	145-155	11	36
β-strand	156	1	35
β-strand	161-164	4	37
β-strand	174-180	7	36
β-strand	186-195	10	36
β-strand	199	1	38
β-strand	202	1	38
β-strand	204-210	7	37
β-strand	215-221	7	37

Chain H: 6 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	39
β-strand	10-13	4	40
β-strand	19-29	11	39
β-strand	33-38	6	40
β-strand	45-49	5	40
β-strand	53-54	2	40
α-helix	55	1
β-strand	62-75	14	39
β-strand	85-90	6	40
α-helix	96	1
β-strand	97-98	2	40
β-strand	102-106	5	40
β-strand	111	1	41
α-helix	112-113	2
β-strand	114-118	5	42
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	42
β-strand	140	1	41
β-strand	145-150	6	43
β-strand	153-154	2	43
β-strand	159-163	5	42
β-strand	173-182	10	42
α-helix	183-187	5
β-strand	191-197	7	43
β-strand	205-210	6	43

3 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
AS4C antibody lignt chain	A, C, E, G	protein	234	Homo sapiens
AS4C antibody heavy chain	B, D, F, H	protein	215	Homo sapiens
Vasodilator-stimulated phosphoprotein,Neuraminidase	I, J, K, L	protein	489	Homo sapiens, Influenza A virus (A/California/VRDL364/2009(mixed))	C3PQB5, P50552 (AlphaFold model)

Sequence of entity 1 (A, C, E, G), FASTA

>9UAX_1 AS4C antibody lignt chain (chains A, C, E, G)
EVQLVESGGGLVQPGGSLRLSCAASGVTFSDHAMNWVRQAPGKGLEWVAGIIGSGGNTKY
ADSVKGRFTISRDNSENTVHLQMNSLRAEDTAMYYCAKTAHTSGHFYNGMDVWGLGTTVT
VSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVL
QSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKHHHHHH

Sequence of entity 2 (B, D, F, H), FASTA

>9UAX_2 AS4C antibody heavy chain (chains B, D, F, H)
DIQMTQSPSSLSASVGDRVTITCQASQDIANYLSWYQQKPGKAPKLLIYDAANLERGVPS
RFSGSGSGTDFTFTISSLLPEDFATYYCQQYDSVPLTFGGGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECS

Sequence of entity 3 (I, J, K, L), FASTA

>9UAX_3 Vasodilator-stimulated phosphoprotein,Neuraminidase (chains I, J, K, L)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPHHHHHHSSSDYSDLQRVKQ
ELLEEVKKELQKVKEEIIEAFVQELRKRGSLVPRGSPSRSEFEYRNWSKPQCDITGFAPF
SKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGKGTTLNNVHSNNTVRDRTPYRTLLM
NELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYNGRLVDSVVSWSK
EILRTQESECVCINGTCTVVMTDGSASGKADTKILFIEEGKIVHTSTLSGSAQHVEECSC
YPRYPGVRCVCRDNWKGSNRPIVDINIKDHSIVSSYVCSGLVGDTPRKNDSSSSSHCLDP
NNEEGGHGVKGWAFDDGNDVWMGRTISEKSRLGYETFKVIEGWSNPKSKLQINRQVIVDR
GNRSGYSGIFSVEGKSCINRCFYVELIRGRKEETEVLWTSNSIVVFCGTSGTYGTGSWPD
GADINLMPI

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

The structure of Myanmar_N2 and AS4C_Fab complex. Sun, J.Q., Yang, H. To be published.

Other PDB entries of the same protein (UniProt C3PQB5), best resolution first:

9UB1 2.35 Å, The structure of Myanmar_N2 and M6B12_Fab complex

Browse structure collections

About this viewer

MolViewer shows 9UAX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.