9UB1: Myanmar_N2 and M6B12_Fab complex

The structure of Myanmar_N2 and M6B12_Fab complex. Determined by electron microscopy at 2.35 Å resolution. Released 8 Apr 2026.

Method: Electron microscopy
Resolution: 2.35 Å
Organisms: Homo sapiens, Influenza A virus (A/California/VRDL364/2009(mixed))
Chains: 12
Atoms: 26,012
Mol. weight: 419.61 kDa
Ligands: CA, NAG
Released: 8 Apr 2026

Explore 9UB1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UB1 contains 52 α-helices and 253 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 4 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	111	1	1
β-strand	116-122	7	1
α-helix	125-128	4
β-strand	135-144	10	2
β-strand	149-159	11	2
α-helix	163-165	3
β-strand	177-182	6	2
α-helix	191	1
β-strand	192-196	5	2
β-strand	199-204	6	3
β-strand	209-216	8	3
β-strand	221-227	7	3
β-strand	230-236	7	3
β-strand	243-244	2	4
β-strand	249	1	3
β-strand	251-253	3	4
β-strand	256-264	9	4
β-strand	270-278	9	4
β-strand	281-287	7	4
β-strand	296-303	8	5
β-strand	306-312	7	5
α-helix	320	1
β-strand	321-326	6	5
β-strand	331-336	6	5
β-strand	373-376	4	6
β-strand	379-384	6	6
β-strand	392-399	8	6
β-strand	411-423	13	6
β-strand	427-433	7	1
β-strand	438-449	12	1
β-strand	459-469	11	1

Chains E, G and I: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	25
β-strand	10-12	3	26
β-strand	17-25	9	25
β-strand	33-39	7	26
β-strand	45-51	7	26
β-strand	58-60	3	26
β-strand	68-73	6	25
β-strand	78-84	7	25
α-helix	88-90	3
β-strand	92-99	8	26
β-strand	120-124	5	26
β-strand	133-137	5	27
β-strand	148-156	9	27
β-strand	164-167	4	28
β-strand	176-178	3	27
α-helix	179-181	3
β-strand	182-183	2	27
β-strand	189-198	10	27
α-helix	199-204	6
β-strand	207-213	7	28
α-helix	214-216	3
β-strand	218-224	7	28

Chains F, H, J and L: 5 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	29
β-strand	10-13	4	30
β-strand	18-24	7	29
β-strand	33-38	6	30
β-strand	45-49	5	30
β-strand	53-54	2	30
α-helix	55	1
β-strand	62-66	5	29
β-strand	70-76	7	29
β-strand	85-90	6	30
α-helix	96	1
β-strand	97-98	2	30
β-strand	102-106	5	30
β-strand	114-118	5	31
α-helix	122-127	6
β-strand	130-139	10	31
β-strand	145-150	6	32
β-strand	159-163	5	31
α-helix	165-167	3
β-strand	173-181	9	31
α-helix	184-187	4
β-strand	191-197	7	32
β-strand	205-210	6	32

Chain K: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	49
β-strand	10-12	3	50
β-strand	17-25	9	49
β-strand	33-39	7	50
β-strand	45-51	7	50
β-strand	58-60	3	50
β-strand	68-73	6	49
β-strand	78-84	7	49
α-helix	88-90	3
β-strand	92-99	8	50
β-strand	116	1	50
β-strand	120-124	5	50
β-strand	133-137	5	51
β-strand	148-156	9	51
β-strand	164-167	4	52
β-strand	176-178	3	51
α-helix	179-181	3
β-strand	182-183	2	51
β-strand	189-198	10	51
α-helix	199-204	6
β-strand	207-213	7	52
α-helix	214-216	3
β-strand	218-224	7	52

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vasodilator-stimulated phosphoprotein,Neuraminidase	A, B, C, D	protein	489	Homo sapiens, Influenza A virus (A/California/VRDL364/2009(mixed))	C3PQB5, P50552 (AlphaFold model)
M6B12 antibody heavy chain	E, G, I, K	protein	231	Homo sapiens
M6B12 antibody light chain	F, H, J, L	protein	215	Homo sapiens

Sequence of entity 1 (A, B, C, D), FASTA

>9UB1_1 Vasodilator-stimulated phosphoprotein,Neuraminidase (chains A, B, C, D)
MLLVNQSHQGFNKEHTSKMVSAIVLYVLLAAAAHSAFAADPHHHHHHSSSDYSDLQRVKQ
ELLEEVKKELQKVKEEIIEAFVQELRKRGSLVPRGSPSRSEFEYRNWSKPQCDITGFAPF
SKDNSIRLSAGGDIWVTREPYVSCDPDKCYQFALGKGTTLNNVHSNNTVRDRTPYRTLLM
NELGVPFHLGTKQVCIAWSSSSCHDGKAWLHVCITGDDKNATASFIYNGRLVDSVVSWSK
EILRTQESECVCINGTCTVVMTDGSASGKADTKILFIEEGKIVHTSTLSGSAQHVEECSC
YPRYPGVRCVCRDNWKGSNRPIVDINIKDHSIVSSYVCSGLVGDTPRKNDSSSSSHCLDP
NNEEGGHGVKGWAFDDGNDVWMGRTISEKSRLGYETFKVIEGWSNPKSKLQINRQVIVDR
GNRSGYSGIFSVEGKSCINRCFYVELIRGRKEETEVLWTSNSIVVFCGTSGTYGTGSWPD
GADINLMPI

Sequence of entity 2 (E, G, I, K), FASTA

>9UB1_2 M6B12 antibody heavy chain (chains E, G, I, K)
EVQLVESGGGLVQPGGSLRLSCTVSGFTFTSYEINWVRQAPGKGLEWVSYISQSGSTIYY
TDSVQGRFTISRDNAENSVYLQMDSLRVEDTAVYYCARDRLPDRDSGDYESRFDFWGQGT
LVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFP
AVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDK

Sequence of entity 3 (F, H, J, L), FASTA

>9UB1_3 M6B12 antibody light chain (chains F, H, J, L)
DIQMTQSPSSLSASVGDRVTITCQASQDISMHLNWYQQKPGRAPKLLIHGASHLETGGPS
RFSGSGSGTDFTFTVSNLQPEDIATYYCQQYFKIPYTFGQGTTLAIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGECS

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	4
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12

Primary citation

The structure of Myanmar_N2 and M6B12_Fab complex. Sun, J.Q., Yang, H. To be published.

Other PDB entries of the same protein (UniProt C3PQB5), best resolution first:

9UAX 2.71 Å, The structure of Myanmar_N2 and AS4C_Fab complex

Browse structure collections

About this viewer

MolViewer shows 9UB1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.