9UJ2: PDB entry 9UJ2

14-3-3 zeta chimera with the S202R peptide of SARS-CoV-2 N (residues 200-213). Determined by X-ray diffraction at 1.8 Å resolution. Released 21 May 2025.

Method: X-ray diffraction
Resolution: 1.8 Å
Organisms: Homo sapiens, Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 4,448
Mol. weight: 57.48 kDa
Released: 21 May 2025

Explore 9UJ2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UJ2 contains 29 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-31	13
α-helix	34-37	4
α-helix	38-66	29
α-helix	73-100	28
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-130	19
α-helix	136-159	24
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-200	16
α-helix	203-205	3
α-helix	208-230	23
α-helix	235-237	3

Chain B: 14 helices, 0 β-strands

Element	Residues	Length
α-helix	3-16	14
α-helix	19-31	13
α-helix	34-37	4
α-helix	38-68	31
α-helix	74-100	27
α-helix	101-105	5
α-helix	106-108	3
α-helix	112-130	19
α-helix	135-159	25
α-helix	165-176	12
α-helix	177-181	5
α-helix	185-201	17
α-helix	203-205	3
α-helix	211-228	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein zeta/delta,Peptide from Nucleoprotein	B	protein	249	Homo sapiens, Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model), P63104 (AlphaFold model)
14-3-3 protein zeta/delta,Peptide from Nucleoprotein	A	protein	249	Homo sapiens, Severe acute respiratory syndrome coronavirus 2	P0DTC9 (AlphaFold model), P63104 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>9UJ2_1 14-3-3 protein zeta/delta,Peptide from Nucleoprotein (chains B)
GPHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
AWRVVSSIEQKTEGAAAAQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGGGGSRRG
TSPARMAGN

Sequence of entity 2 (A), FASTA

>9UJ2_2 14-3-3 protein zeta/delta,Peptide from Nucleoprotein (chains A)
GPHMDKNELVQKAKLAEQAERYDDMAACMKSVTEQGAELSNEERNLLSVAYKNVVGARRS
AWRVVSSIEQKTEGAAAAQQMAREYREKIETELRDICNDVLSLLEKFLIPNASQAESKVF
YLKMKGDYYRYLAEVAAGDDKKGIVDQSQQAYQEAFEISAAAMQPTHPIRLGLALNFSVF
YYEILNSPEKACSLAKTAFDEAIAELDTLSEESYKDSTLIMQLLRDNLTLWTGGGGSRRG
TSPARMAGN

Primary citation

High-resolution structure reveals enhanced 14-3-3 binding by a mutant SARS-CoV-2 nucleoprotein variant with improved replicative fitness. Perfilova, K.V., Matyuta, I.O., Minyaev, M.E. et al. Biochem Biophys Res Commun (2025) 767:151915-151915. DOI 10.1016/j.bbrc.2025.151915 · PubMed

Other PDB entries of the same protein (UniProt P0DTC9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LUZ 1.1 Å, GQTVTK segment from the Nucleoprotein of SARS-CoV-2, residues 243-248
7LTU 1.12 Å, Aalall segment from the nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 1
7VBF 1.3 Å, 1.3 Angstrom Resolution Crystal Structure of SARS-CoV-2 Nucleocapsid dimerization…
9F2H 1.3 Å, Crystal structure of SARS-CoV-2 N-protein C-terminal domain in complex with riluzole
7LV2 1.3 Å, GSQASS segment from the Nucleoprotein of SARS-CoV-2, residues 179-184
7LUX 1.3 Å, AALALL segment from the Nucleoprotein of SARS-CoV-2, residues 217-222, crystal form 2
7KGQ 1.34 Å, Crystal Structure of HLA-A*0201in complex with SARS-CoV-2 N222-230
6ZCO 1.36 Å, Crystal Structure of C-terminal Dimerization Domain of Nucleocapsid Phosphoprotein from…
7KGP 1.4 Å, Crystal Structure of HLA-A*0201 in complex with SARS-CoV-2 N316-324
9IN1 1.4 Å, Crystal Structure of C-terminal domain of nucleocapsid protein from SARS-CoV-2
6WZO 1.42 Å, Structure of SARS-CoV-2 Nucleocapsid dimerization domain, P1 form
7N0R 1.42 Å, Structure of the SARS-CoV-2 N protein RNA-binding domain bound to single-domain antibody…

Browse structure collections

About this viewer

MolViewer shows 9UJ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.