9UJM: Membrane protein

Name: PDB 9UJM: Structure of a membrane protein
Published: 2026-04-29
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: membrane protein

Structure of a membrane protein. Determined by electron microscopy at 3.07 Å resolution. Released 29 Apr 2026.

Method: Electron microscopy
Resolution: 3.07 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,906
Mol. weight: 44.52 kDa
Ligands: A1L11
Released: 29 Apr 2026

Explore 9UJM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UJM contains 16 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 16 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	77-101	25
α-helix	103-105	3
α-helix	108-126	19
α-helix	128-136	9
α-helix	145-177	33
α-helix	190-207	18
α-helix	209-216	8
α-helix	218-221	4
β-strand	222	1	1
β-strand	227	1	1
α-helix	232-239	8
α-helix	240-244	5
α-helix	245-263	19
α-helix	313-348	36
α-helix	356-371	16
α-helix	372-374	3
α-helix	376-383	8
α-helix	385-394	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
5-hydroxytryptamine receptor 2A	C	protein	389	Homo sapiens	P28223 (AlphaFold model)

Sequence of entity 1 (C), FASTA

>9UJM_1 5-hydroxytryptamine receptor 2A (chains C)
MKTIIALSYIFCLVFADYKDDDDAKLQTLSLLHLQEKNWSALLTAVVIILTIAGNILVIM
AVSLEKKLQNATNYFLMSLAIADMLLGFLVMPVSMLTILYGYRWPLPSKLCAVWIYLDVL
FSTASIMHLCAISLDRYVAIQNPIHHSRFNSRTKAFLKIIAVWTISVGISMPIPVFGLQD
DSKVFKEGSCLLADDNFVLIGSFVSFFIPATIMVITYFLTIKSLQKEATLCVSDLGTRAK
LASFSFLPQSSLSSEKLFQRSIHREPGSYTGRRTMQSISNEQKACKVLGIVFFLFVVMWC
PFFITNIMAVICKESCNEDVIGALLNVFVWIGYASSAVNPLVYTLFNKTYRSAFSRYIQC
QYKENKKPGRPLEVLFQGPHHHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
A1L11	Pimavanserin	C25 H34 F N3 O2	1

Primary citation

Structure of a membrane protein. Parajulee, A., Kim, K. To be published.

Other PDB entries of the same protein (UniProt P28223 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WC8 2.45 Å, Crystal structure of serotonin 2A receptor in complex with lumateperone
7WC9 2.5 Å, Crystal structure of serotonin 2A receptor in complex with non-hallucinogenic…
9AS8 2.54 Å, Global reconstruction of 5-HT2AR bound to psilocin in complex with a mini-Gq protein and…
7WC6 2.6 Å, Crystal structure of serotonin 2A receptor in complex with LSD
7WC7 2.6 Å, Crystal structure of serotonin 2A receptor in complex with lisuride
9LL8 2.62 Å, Psilocin-bound Serotonin 2A (5-HT2A) receptor-Gi complex
8JT8 2.7 Å, Crystal structure of 5-HT2AR in complex with (R)-IHCH-7179
9AS7 2.72 Å, Local refinement of 5-HT2AR bound to psilocin in complex with a mini-Gq and scFv16…
9LL9 2.76 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gq complex
8UWL 2.8 Å, 5-HT2AR bound to Lisuride in complex with a mini-Gq protein and an active-state…
9J87 2.84 Å, Structure of Receptor
9LL7 2.84 Å, DOI-bound Serotonin 2A (5-HT2A) receptor-Gi complex

Browse structure collections

About this viewer

MolViewer shows 9UJM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.