9UKQ: Glycogen phosphorylase from Escherichia coli

Crystal structure of glycogen phosphorylase from Escherichia coli. Determined by X-ray diffraction at 3.5 Å resolution. Released 18 Feb 2026.

Method: X-ray diffraction
Resolution: 3.5 Å
Organism: Escherichia coli K12
Chains: 6
Atoms: 38,963
Mol. weight: 562.19 kDa
Released: 18 Feb 2026

Explore 9UKQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UKQ contains 281 α-helices and 154 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 47 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	33-35	3
α-helix	38-66	29
β-strand	71-75	5	1
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-139	15
β-strand	144-149	6	1
β-strand	157-161	5	2
β-strand	164-168	5	2
β-strand	181-192	12	1
β-strand	195-199	5	3
β-strand	202-206	5	3
β-strand	209-219	11	1
β-strand	230-237	8	1
α-helix	242-245	4
α-helix	252-256	5
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	1
α-helix	323-326	4
α-helix	327-333	7
α-helix	334-338	5
α-helix	343-353	11
β-strand	354-357	4	1
β-strand	368-370	3	4
α-helix	371-377	7
α-helix	379-399	21
α-helix	406-409	4
β-strand	413-414	2	4
β-strand	420-422	3	4
α-helix	423-429	7
β-strand	433-436	4	1
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	1
β-strand	468	1	5
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	501-504	4
α-helix	509-535	27
β-strand	544-549	6	6
β-strand	552	1	7
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	6
β-strand	591	1	7
α-helix	596-612	17
β-strand	622-627	6	6
α-helix	632-638	7
α-helix	639-641	3
β-strand	644-647	4	6
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	6
α-helix	677-685	9
β-strand	691-692	2	6
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	5
α-helix	796-803	8
α-helix	804-808	5

Chain B: 48 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	33-35	3
α-helix	38-67	30
β-strand	71-75	5	8
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-139	15
β-strand	144-149	6	8
β-strand	157-161	5	9
β-strand	164-168	5	9
α-helix	172-175	4
β-strand	181-192	12	8
β-strand	195-198	4	10
β-strand	203-206	4	10
β-strand	209-220	12	8
α-helix	221-222	2
β-strand	229-238	10	8
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	8
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	8
β-strand	368-370	3	11
α-helix	371-377	7
α-helix	379-399	21
α-helix	405-409	5
β-strand	413-414	2	11
β-strand	420-422	3	11
α-helix	423-429	7
β-strand	433-436	4	8
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	8
β-strand	468	1	12
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	499-502	4
α-helix	510-535	26
β-strand	544-549	6	13
β-strand	552	1	14
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	13
β-strand	591	1	14
α-helix	596-612	17
β-strand	622-627	6	13
α-helix	632-638	7
α-helix	639-641	3
β-strand	644-647	4	13
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	13
α-helix	677-685	9
β-strand	691-692	2	13
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	12
α-helix	796-803	8
α-helix	804-808	5

Chain C: 48 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	33-35	3
α-helix	38-66	29
β-strand	71-75	5	15
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	116-118	3
α-helix	125-139	15
β-strand	145-149	5	15
β-strand	157-161	5	16
β-strand	164-168	5	16
β-strand	181-192	12	15
β-strand	195-199	5	17
β-strand	202-206	5	17
β-strand	209-220	12	15
α-helix	221-222	2
β-strand	229-237	9	15
α-helix	242-245	4
α-helix	252-256	5
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	15
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	15
β-strand	368-370	3	18
α-helix	371-377	7
α-helix	379-399	21
α-helix	405-409	5
β-strand	413-414	2	18
β-strand	420-422	3	18
α-helix	423-429	7
β-strand	433-436	4	15
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	15
β-strand	468	1	19
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	492-494	3
α-helix	501-504	4
α-helix	509-535	27
β-strand	544-549	6	20
β-strand	552	1	21
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	20
β-strand	591	1	21
α-helix	596-612	17
β-strand	622-627	6	20
α-helix	632-638	7
α-helix	639-641	3
β-strand	644-647	4	20
α-helix	649-650	2
α-helix	658-665	8
α-helix	668	1
β-strand	669-672	4	20
α-helix	677-685	9
β-strand	691-692	2	20
α-helix	697-705	9
α-helix	710-713	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	19
α-helix	796-803	8
α-helix	804-808	5

Chain D: 46 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	12-27	16
α-helix	38-67	30
β-strand	71-75	5	22
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	116-118	3
α-helix	125-139	15
β-strand	144-149	6	22
β-strand	157-161	5	23
β-strand	164-168	5	23
α-helix	172-175	4
β-strand	181-192	12	22
β-strand	195-198	4	24
β-strand	203-206	4	24
β-strand	209-220	12	22
α-helix	221-222	2
β-strand	229-238	10	22
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	22
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	22
β-strand	368-370	3	25
α-helix	371-377	7
α-helix	379-399	21
α-helix	406-409	4
β-strand	413-414	2	25
β-strand	420-422	3	25
α-helix	423-429	7
β-strand	433-436	4	22
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	22
β-strand	468	1	26
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	499-502	4
α-helix	510-535	26
β-strand	544-549	6	27
β-strand	552	1	28
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	27
β-strand	591	1	28
α-helix	596-613	18
β-strand	622-627	6	27
α-helix	632-641	10
β-strand	644-647	4	27
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	27
α-helix	677-685	9
β-strand	691-692	2	27
α-helix	697-705	9
α-helix	711-714	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	26
α-helix	796-803	8
α-helix	804-808	5

Chain E: 46 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	14-23	10
α-helix	24-28	5
α-helix	38-66	29
β-strand	71-75	5	29
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-139	15
β-strand	145-149	5	29
β-strand	157-161	5	30
β-strand	164-168	5	30
α-helix	172-175	4
β-strand	181-192	12	29
β-strand	195-198	4	31
β-strand	203-206	4	31
β-strand	209-220	12	29
β-strand	229-238	10	29
α-helix	242-245	4
α-helix	252-256	5
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	29
α-helix	323-326	4
α-helix	327-337	11
α-helix	343-353	11
β-strand	354-357	4	29
β-strand	368-370	3	32
α-helix	371-377	7
α-helix	379-399	21
α-helix	406-409	4
β-strand	413-414	2	32
β-strand	420-422	3	32
α-helix	423-429	7
β-strand	433-436	4	29
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-463	3	29
β-strand	468	1	33
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	501-504	4
α-helix	509-535	27
β-strand	544-549	6	34
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	34
α-helix	596-612	17
β-strand	622-627	6	34
α-helix	632-641	10
β-strand	644-647	4	34
α-helix	649-650	2
α-helix	658-664	7
α-helix	668	1
β-strand	669-672	4	34
α-helix	677-685	9
β-strand	691-692	2	34
α-helix	697-705	9
α-helix	710-713	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	33
α-helix	796-803	8
α-helix	804-808	5

Chain F: 46 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	14-27	14
α-helix	33-35	3
α-helix	38-65	28
β-strand	71-75	5	35
α-helix	85-92	8
α-helix	95-103	9
α-helix	109-113	5
α-helix	117-118	2
α-helix	125-139	15
β-strand	144-149	6	35
β-strand	157-161	5	36
β-strand	164-168	5	36
α-helix	172-175	4
β-strand	181-192	12	35
β-strand	195-198	4	37
β-strand	203-206	4	37
β-strand	209-220	12	35
α-helix	221-222	2
β-strand	229-237	9	35
α-helix	242-245	4
α-helix	253-256	4
α-helix	262-266	5
α-helix	279-305	27
α-helix	311-314	4
β-strand	315-319	5	35
α-helix	323-326	4
α-helix	327-339	13
α-helix	343-353	11
β-strand	354-357	4	35
β-strand	368-370	3	38
α-helix	371-377	7
α-helix	379-399	21
α-helix	406-409	4
β-strand	413-414	2	38
β-strand	420-422	3	38
α-helix	423-429	7
β-strand	433-435	3	35
α-helix	439-444	6
α-helix	445-449	5
α-helix	451-456	6
β-strand	461-462	2	35
β-strand	468	1	39
α-helix	470	1
α-helix	471-476	6
α-helix	479-489	11
α-helix	499-502	4
α-helix	510-535	26
β-strand	544-549	6	40
β-strand	552	1	41
α-helix	554-556	3
α-helix	558-572	15
α-helix	580-582	3
β-strand	583-588	6	40
β-strand	591	1	41
α-helix	596-612	17
β-strand	622-626	5	40
α-helix	632-638	7
β-strand	644-647	4	40
α-helix	649-650	2
α-helix	658-665	8
α-helix	668	1
β-strand	669-672	4	40
α-helix	677-685	9
β-strand	691-692	2	40
α-helix	697-705	9
α-helix	710-713	4
α-helix	718-728	11
α-helix	741-748	8
α-helix	760-774	15
α-helix	777-789	13
β-strand	795	1	39
α-helix	796-806	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glycogen phosphorylase	A, B, C, D, E, F	protein	817	Escherichia coli K12	P0AC86 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>9UKQ_1 Glycogen phosphorylase (chains A, B, C, D, E, F)
MGMNAPFTYSSPTLSVEALKHSIAYKLMFTIGKDPVVANKHEWLNATLFAVRDRLVERWL
RSNRAQLSQETRQVYYLSMEFLIGRTLSNAMLSLGIYEDVQGALEAMGLNLEELIDEEND
PGLGNGGLGRLAACFLDSLATLGLPGRGYGIRYDYGMFKQNIVNGSQKESPDYWLEYGNP
WEFKRHNTRYKVRFGGRIQQEGKKTRWIETEEILGVAYDQIIPGYDTDATNTLRLWSAQA
SSEINLGKFNQGDYFAAVEDKNHSENVSRVLYPDDSTYSGRELRLRQEYFLVSSTIQDIL
SRHYQLHKTYDNLADKIAIHLNDTHPVLSIPEMMRLLIDEHQFSWDDAFEVCCQVFSYTN
HTLMSEALETWPVDMLGKILPRHLQIIFEINDYFLKTLQEQYPNDTDLLGRASIIDESNG
RRVRMAWLAVVVSHKVNGVSELHSNLMVQSLFADFAKIFPGRFTNVTNGVTPRRWLAVAN
PSLSAVLDEHLGRNWRTDLSLLNELQQHCDFPMVNHAVHQAKLENKKRLAEYIAQQLNVV
VNPKALFDVQIKRIHEYKRQLMNVLHVITRYNRIKADPDAKWVPRVNIFGGKAASAYYMA
KHIIHLINDVAKVINNDPQIGDKLKVVFIPNYSVSLAQLIIPAADLSEQISLAGTEASGT
SNMKFALNGALTIGTLDGANVEMLDHVGADNIFIFGNTAEEVEELRRQGYKPREYYEKDE
ELHQVLTQIGSGVFSPEDPGRYRDLVDSLINFGDHYQVLADYRSYVDCQDKVDELYELQE
EWTAKAMLNIANMGYFSSDRTIKEYADHIWHIDPVRL

Primary citation

Structural and mechanistic diversity of glycogen phosphorylases from gut bacteria. Shobu, K., Takai, M., Tanino, H. et al. Proc Natl Acad Sci U S A (2026) 123:e2518513123-e2518513123. DOI 10.1073/pnas.2518513123 · PubMed

Other PDB entries of the same protein (UniProt P0AC86 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9S8K 2.06 Å, Structure of glycogen phosphorylase - tetrameric form - in complex with HPr from…
9S8B 2.79 Å, Structure of glycogen phosphorylase - dimeric form - in complex with HPr from…
9M9P 2.93 Å, Glycogen phosphorylase dimer from E. coli
9S86 2.97 Å, Structure of glycogen phosphorylase - tetrameric form - from Escherichia coli
9S7V 3.1 Å, Structure of glycogen phosphorylase - dimeric form - from Escherichia coli
9V16 3.45 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant in complex with AMP
9UKR 3.55 Å, Crystal structure of glycogen phosphorylase from E. coli in complex with AMP
9V17 3.7 Å, Crystal structure of E. coli glycogen phosphorylase N185A/R267E mutant

Browse structure collections

About this viewer

MolViewer shows 9UKQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.