9UVY: Vasopressin receptor 2 (V2R)-ARK1 with tolvaptan

Cryo-EM structure of Vasopressin receptor 2 (V2R)-ARK1 with tolvaptan. Determined by electron microscopy at 2.98 Å resolution. Released 6 May 2026.

Method: Electron microscopy
Resolution: 2.98 Å
Organisms: Homo sapiens, synthetic construct
Chains: 1
Atoms: 5,247
Mol. weight: 86.7 kDa
Ligands: A1IT8
Released: 6 May 2026

Explore 9UVY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9UVY contains 28 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 28 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	37-68	32
α-helix	74-86	13
α-helix	93-95	3
α-helix	96-100	5
α-helix	101-102	2
α-helix	109-119	11
α-helix	128-142	15
α-helix	158-170	13
α-helix	172-176	5
β-strand	181	1	1
β-strand	191	1	1
α-helix	202-210	9
α-helix	211-215	5
α-helix	216-266	51
α-helix	270-296	27
α-helix	300-326	27
α-helix	332-356	25
α-helix	361-385	25
α-helix	390-409	20
α-helix	413-427	15
α-helix	430-447	18
α-helix	451-473	23
α-helix	477-502	26
α-helix	507-526	20
α-helix	534-558	25
α-helix	563-589	27
α-helix	593-653	61
α-helix	661-671	11
α-helix	673-684	12
α-helix	687-697	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Vasopressin V2 receptor,ARK1	A	protein	765	Homo sapiens, synthetic construct	P30518 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9UVY_1 Vasopressin V2 receptor,ARK1 (chains A)
MKTIIALSYIFCLVFADYKDDDDAENLYFQGMLMASTTSAVPGHPSLPSLPSNSSQERPL
DTRDPLLARAELALLSIVFVAVALSNGLVLAALARRGRRGHWAPIHVFIGHLCLADLAVA
LFQVLPQLAWKATDRFRGPDALCRAVKYLQMVGMYASSYMILAMTLDRHRAICRPMLAYR
HGSGAHWNRPVLVAWAFSLLLSLPQLFIFAQRNVEGGSGVTDCWACFAEPWGRRTYVTWI
ALMVFVAPTLGIAACQVLIFREIHASLELRRLLREQGEKLLKLAEESEKKIKEAIEKGED
VVKVATEETHKLIKAIWESSFEVARLLGVPEEVLEKFRKELEKLLEESKKRIEEAIKKGE
DVLKVVEEEAKKLREHSEKFLETARSLGVDPRPLERLARIVRVVEESLVRIVKAIKEGED
VEKVLLSESTLIKSSIILSSGLDPREAYEELLATYEETRDSELVKEFVELVRELLRLRGE
PEELVRQLDKLIEAIDRMEKAVAEGEDTLPLFLELAREILKALSDVARILAEREGLDVEL
IDEIVDTASRLLEEVIKKAKEGEDLDEEEEKVKKELEELKKRTEERARALGQDVELVRTI
VDSLSTLLSEIVEGIKRVKEGEDPLEVLARVVLTATLQILELVRTAERRRRERVAKTVRM
TLVIVVVYVLCWAPFFLVQLWAAWDPEAPLEGAPFVLLMLLASLNSCTNPWIYASFSSSV
SSELRSLLCCARGRTPPSLGPQDESCTTASSSLAKDTSSLEVLFQ

Ligands and cofactors

ID	Name	Formula	Copies
A1IT8	(R)-Tolvaptan	C26 H25 Cl N2 O3	1

Primary citation

A Rapid and Universal Pipeline for High-Resolution GPCR Structure Determination through <em>In Silico</em> Construct Optimization and de novo Protein Design. Kojima, A., Kawakami, K., Kobayashi, N. et al. bioRxiv (2026). DOI 10.64898/2026.04.02.716066

Other PDB entries of the same protein (UniProt P30518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
9HAP 2.5 Å, Cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
9HB3 2.5 Å, cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
7DW9 2.6 Å, Cryo-EM structure of human V2 vasopressin receptor in complex with an Gs protein
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9WSX 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex

Browse structure collections

About this viewer

MolViewer shows 9UVY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.