The DCY1020-bound structure of TMEM175. Determined by electron microscopy at 3.4 Å resolution. Released 17 Sept 2025.
Explore 9VSP in 3D Show helices and sheets RCSB PDB PDBe
9VSP contains 45 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 1 |
| α-helix | 33-49 | 17 | |
| α-helix | 52-57 | 6 | |
| α-helix | 70-101 | 32 | |
| β-strand | 102 | 1 | 2 |
| β-strand | 105 | 1 | 1 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 137-163 | 27 | |
| α-helix | 165-167 | 3 | |
| β-strand | 168 | 1 | 2 |
| α-helix | 170-174 | 5 | |
| α-helix | 178-203 | 26 | |
| α-helix | 207-223 | 17 | |
| α-helix | 258-283 | 26 | |
| α-helix | 286-287 | 2 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-332 | 34 | |
| β-strand | 334 | 1 | 3 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-399 | 31 | |
| α-helix | 401-404 | 4 | |
| β-strand | 405 | 1 | 3 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-439 | 24 | |
| α-helix | 444-460 | 17 | |
| α-helix | 462-474 | 13 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 31 | 1 | 4 |
| α-helix | 34-48 | 15 | |
| α-helix | 49-51 | 3 | |
| α-helix | 52-57 | 6 | |
| α-helix | 70-101 | 32 | |
| β-strand | 105 | 1 | 4 |
| α-helix | 107-120 | 14 | |
| α-helix | 123-132 | 10 | |
| α-helix | 137-163 | 27 | |
| α-helix | 165-167 | 3 | |
| α-helix | 170-174 | 5 | |
| α-helix | 178-202 | 25 | |
| α-helix | 207-223 | 17 | |
| β-strand | 255-256 | 2 | 5 |
| α-helix | 257 | 1 | |
| α-helix | 258-283 | 26 | |
| α-helix | 286-287 | 2 | |
| α-helix | 288-294 | 7 | |
| α-helix | 299-332 | 34 | |
| β-strand | 334 | 1 | 6 |
| β-strand | 337-338 | 2 | 5 |
| α-helix | 339-352 | 14 | |
| α-helix | 355-363 | 9 | |
| α-helix | 369-398 | 30 | |
| α-helix | 401-404 | 4 | |
| β-strand | 405 | 1 | 6 |
| α-helix | 407-409 | 3 | |
| α-helix | 416-439 | 24 | |
| α-helix | 444-475 | 32 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Endosomal/lysosomal proton channel TMEM175 | A, B | protein | 504 | Homo sapiens | Q9BSA9 (AlphaFold model) |
>9VSP_1 Endosomal/lysosomal proton channel TMEM175 (chains A, B) MSQPRTPEQALDTPGDCPPGRRDEDAGEGIQCSQRMLSFSDALLSIIATVMILPVTHTEI SPEQQFDRSVQRLLATRIAVYLMTFLIVTVAWAAHTRLFQVVGKTDDTLALLNLACMMTI TFLPYTFSLMVTFPDVPLGIFLFCVCVIAIGVVQALIVGYAFHFPHLLSPQIQRSAHRAL YRRHVLGIVLQGPALCFAAAIFSLFFVPLSYLLMVTVILLPYVSKVTGWCRDRLLGHREP SAHPVEVFSFDLHEPLSKERVEAFSDGVYAIVATLLILDICEDNVPDPKDVKERFSGSLV AALSATGPRFLAYFGSFATVGLLWFAHHSLFLHVRKATRAMGLLNTLSLAFVGGLPLAYQ QTSAFARQPRDELERVRVSCTIIFLASIFQLAMWTTALLHQAETLQPSVWFGGREHVLMF AKLALYPCASLLAFASTCLLSRFSVGIFHLMQIAVPCAFLLLRLLVGLALATLRVLRGLA RPEHPPPAPTGQDDPQSQLLPAPC
| ID | Name | Formula | Copies |
|---|---|---|---|
| A1ETD | (2S)-2-butyl-6,7-bis(chloranyl)-2-cyclopentyl-5-[3-(1H-1,2,3,4-tetrazol-5-yl)pr… | C22 H28 Cl2 N4 O2 | 2 |
Structural insights into the activation of TMEM175 by small molecule. Zhu, X., Ping, M., Liu, H. et al. Neuron (2025) 113:3567. DOI 10.1016/j.neuron.2025.07.029 · PubMed
Other PDB entries of the same protein (UniProt Q9BSA9 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9VSP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.