9VZG: Stimulator of interferon genes protein

Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for Respiratory Syncytial Virus Therapy. Determined by X-ray diffraction at 1.74 Å resolution. Released 29 Jul 2026.

Method: X-ray diffraction
Resolution: 1.74 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,483
Mol. weight: 22.16 kDa
Ligands: A1EUO
Released: 29 Jul 2026

Explore 9VZG in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9VZG contains 9 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	6-14	9
α-helix	15-19	5
α-helix	20-35	16
β-strand	49-54	6	1
α-helix	63-65	3
β-strand	70-83	14	1
β-strand	86-100	15	1
β-strand	103-112	10	1
α-helix	115-124	10
α-helix	126-128	3
α-helix	132-134	3
α-helix	135-151	17
β-strand	160-165	6	1
α-helix	176-187	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	A	protein	190	Homo sapiens	Q86WV6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9VZG_1 Stimulator of interferon genes protein (chains A)
KGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLYILLPLDCGVP
DNLSMADPNIRFLDKLPQQTGDHAGIKDRVYSNSIYELLENGQRAGTCVLEYATPLQTLF
AMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPADDSSFSLSQEV
LRHLRQEEKE

Ligands and cofactors

ID	Name	Formula	Copies
A1EUO	(1~{R},2~{S})-2-[(3-fluoranyl-5,6-dimethoxy-1-benzoselenophen-2-yl)carbonyl]cyc…	C16 H15 F O5 Se	1

Primary citation

Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for Respiratory Syncytial Virus Therapy. Bian, J.L., Pan, L.X., Li, Z.Y. et al. To be published.

Other PDB entries of the same protein (UniProt Q86WV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MX3 1.36 Å, Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
4EMT 1.5 Å, Crystal Structure of human STING bound to c-di-GMP
6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
9CUD 1.53 Å, Human STING G230A/R293Q variant bound to diABZI-i
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
7ZKU 1.7 Å, Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP)
8STI 1.72 Å, human STING with agonist XMT-1616
6MX0 1.73 Å, Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4
6XNP 1.77 Å, Crystal Structure of Human STING CTD complex with SR-717
7KW1 1.8 Å, Structure of hSTING in complex with novel carbocyclic pyrimidine CDN-3

Browse structure collections

About this viewer

MolViewer shows 9VZG directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.