Crystal structure of the mutant LC3B in complex with p62. Determined by X-ray diffraction at 1.67 Å resolution. Released 29 Jul 2026.
Explore 9W2N in 3D Show helices and sheets RCSB PDB PDBe
9W2N contains 7 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-10 | 4 | |
| α-helix | 13-26 | 14 | |
| β-strand | 30-37 | 8 | 1 |
| α-helix | 38 | 1 | |
| α-helix | 45-47 | 3 | |
| β-strand | 51-55 | 5 | 1 |
| β-strand | 59 | 1 | 2 |
| α-helix | 60-70 | 11 | |
| β-strand | 80-83 | 4 | 1 |
| β-strand | 86 | 1 | 1 |
| β-strand | 94 | 1 | 2 |
| α-helix | 95-102 | 8 | |
| β-strand | 109-114 | 6 | 1 |
| α-helix | 117-119 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 341-342 | 2 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Microtubule-associated protein 1 light chain 3 beta | A | protein | 131 | Mus musculus | Q9CQV6 (AlphaFold model) |
| Sequestosome-1 | C | protein | 11 | Mus musculus | Q64337 (AlphaFold model) |
>9W2N_1 Microtubule-associated protein 1 light chain 3 beta (chains A) HHHHHHMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV PDHVNMSELKKIIRRRLQLNANQAFFLLVNGHSMDSFSTPISEVYESERDEDGFLYMVYA SQETFGTAMAV
>9W2N_2 Sequestosome-1 (chains C) SGGDDDWTHLS
A programmable lipid-triggered allosteric site modulates LC3 LIR receptor binding activity. Gahlot, D., Castin, J., Mathur, S. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-76697-9 · PubMed
Other PDB entries of the same protein (UniProt Q9CQV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9W2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.