9W2N: Mutant LC3B

Crystal structure of the mutant LC3B in complex with p62. Determined by X-ray diffraction at 1.67 Å resolution. Released 29 Jul 2026.

Method: X-ray diffraction
Resolution: 1.67 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,191
Mol. weight: 17.03 kDa
Released: 29 Jul 2026

Explore 9W2N in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9W2N contains 7 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-10	4
α-helix	13-26	14
β-strand	30-37	8	1
α-helix	38	1
α-helix	45-47	3
β-strand	51-55	5	1
β-strand	59	1	2
α-helix	60-70	11
β-strand	80-83	4	1
β-strand	86	1	1
β-strand	94	1	2
α-helix	95-102	8
β-strand	109-114	6	1
α-helix	117-119	3

Chain C: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	341-342	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Microtubule-associated protein 1 light chain 3 beta	A	protein	131	Mus musculus	Q9CQV6 (AlphaFold model)
Sequestosome-1	C	protein	11	Mus musculus	Q64337 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9W2N_1 Microtubule-associated protein 1 light chain 3 beta (chains A)
HHHHHHMPSEKTFKQRRSFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLV
PDHVNMSELKKIIRRRLQLNANQAFFLLVNGHSMDSFSTPISEVYESERDEDGFLYMVYA
SQETFGTAMAV

Sequence of entity 2 (C), FASTA

>9W2N_2 Sequestosome-1 (chains C)
SGGDDDWTHLS

Primary citation

A programmable lipid-triggered allosteric site modulates LC3 LIR receptor binding activity. Gahlot, D., Castin, J., Mathur, S. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-76697-9 · PubMed

Other PDB entries of the same protein (UniProt Q9CQV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9W1U 1.6 Å, Crystal structure of mutant apo LC3B
5WRD 1.9 Å, Crystal structure of LC3B in complex with FYCO1 LIR
5YIS 2.2 Å, Crystal Structure of AnkB LIR/LC3B complex
5YIQ 2.6 Å, Crystal structure of AnkG LIR/LC3B complex

Browse structure collections

About this viewer

MolViewer shows 9W2N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.