9W2T: ATP synthase F complex subunit 8
Cryo-EM structure of Fo domain of FoF1-ATPase monomer state on the bovine heart submitochondrial particles. Determined by electron microscopy at 4.1 Å resolution. Released 1 Apr 2026.
- Method
- Electron microscopy
- Resolution
- 4.1 Å
- Organism
- Bos taurus
- Chains
- 17
- Atoms
- 10,026
- Mol. weight
- 146.18 kDa
- Released
- 1 Apr 2026
Explore 9W2T in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9W2T contains 76 α-helices and 6 β-strands across 17 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 8: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-18 | 10 | |
| α-helix | 19-23 | 5 | |
| α-helix | 24-29 | 6 | |
| α-helix | 34-37 | 4 | |
Chain a: 11 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-9 | 3 | |
| α-helix | 20-24 | 5 | |
| α-helix | 26-30 | 5 | |
| β-strand | 36 | 1 | 1 |
| α-helix | 41-57 | 17 | |
| α-helix | 65-68 | 4 | |
| α-helix | 69-85 | 17 | |
| α-helix | 94-96 | 3 | |
| α-helix | 98-126 | 29 | |
| α-helix | 135-137 | 3 | |
| α-helix | 139-181 | 43 | |
| α-helix | 186-224 | 39 | |
Chain b: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-6 | 5 | |
| β-strand | 12-13 | 2 | 2 |
| β-strand | 17-18 | 2 | 2 |
| α-helix | 19-29 | 11 | |
| α-helix | 33-48 | 16 | |
| α-helix | 55-100 | 46 | |
Chain d: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 119-122 | 4 | |
| α-helix | 124-126 | 3 | |
| α-helix | 127-129 | 3 | |
| β-strand | 131 | 1 | 1 |
| α-helix | 132-138 | 7 | |
| α-helix | 140-142 | 3 | |
Chain e: 2 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 5-7 | 3 | |
| α-helix | 8-69 | 62 | |
Chain f: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| β-strand | 15 | 1 | 3 |
| α-helix | 19-25 | 7 | |
| α-helix | 30-48 | 19 | |
| α-helix | 56-59 | 4 | |
| α-helix | 60-73 | 14 | |
| α-helix | 77-81 | 5 | |
Chain g: 6 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 23-36 | 14 | |
| α-helix | 38-40 | 3 | |
| α-helix | 44-60 | 17 | |
| α-helix | 63-65 | 3 | |
| β-strand | 68 | 1 | 3 |
| α-helix | 69-84 | 16 | |
| α-helix | 86-93 | 8 | |
Chain j: 4 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 3-9 | 7 | |
| α-helix | 14-15 | 2 | |
| α-helix | 16-20 | 5 | |
| α-helix | 22-46 | 25 | |
9 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| ATP synthase F(0) complex subunit 8 | 8 | protein | 41 | Bos taurus | P03929 (AlphaFold model) |
| ATP synthase F(0) complex subunit C1, mitochondrial | K, L, M, N, O, P, Q, R | protein | 75 | Bos taurus | P32876 (AlphaFold model) |
| ATP synthase F(0) complex subunit a | a | protein | 224 | Bos taurus | P00847 (AlphaFold model) |
| ATP synthase peripheral stalk subunit b, mitochondrial | b | protein | 112 | Bos taurus | P13619 (AlphaFold model) |
| ATP synthase peripheral stalk subunit d, mitochondrial | d | protein | 51 | Bos taurus | P13620 |
| ATP synthase F(0) complex subunit e, mitochondrial | e | protein | 69 | Bos taurus | Q00361 |
| ATP synthase F(0) complex subunit f, mitochondrial | f | protein | 83 | Bos taurus | Q28851 |
| ATP synthase F(0) complex subunit g, mitochondrial | g | protein | 79 | Bos taurus | Q28852 |
| ATP synthase F(0) complex subunit j, mitochondrial | j | protein | 48 | Bos taurus | P14790 |
| ATP synthase F(0) complex subunit k, mitochondrial | k | protein | 36 | Bos taurus | Q3ZBI7 |
Sequence of entity 1 (8), FASTA
>9W2T_1 ATP synthase F(0) complex subunit 8 (chains 8)
MPQLDTSTWLTMILSMFLTLFIIFQLKVSKHNFYHNPELTP
Sequence of entity 2 (K, L, M, N, O, P, Q, R), FASTA
>9W2T_2 ATP synthase F(0) complex subunit C1, mitochondrial (chains K, L, M, N, O, P, Q, R)
DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM
GLFCLMVAFLILFAM
Sequence of entity 3 (a), FASTA
>9W2T_3 ATP synthase F(0) complex subunit a (chains a)
ENLFTSFITPVILGLPLVTLIVLFPSLLFPTSNRLVSNRFVTLQQWMLQLVSKQMMSIHN
SKGQTWTLMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGAVITGFRNKTK
ASLAHFLPQGTPTPLIPMLVIIETISLFIQPMALAVRLTANITAGHLLIHLIGGATLALM
SISTTTALITFTILILLTILEFAVAMIQAYVFTLLVSLYLHDNT
Sequence of entity 4 (b), FASTA
>9W2T_4 ATP synthase peripheral stalk subunit b, mitochondrial (chains b)
PVPPLPEHGGKVRFGLIPEEFFQFLYPKTGVTGPYVLGTGLILYLLSKEIYVITPETFSA
ISTIGFLVYIVKKYGASVGEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEK
Sequence of entity 5 (d), FASTA
>9W2T_5 ATP synthase peripheral stalk subunit d, mitochondrial (chains d)
TRIQEYEKELEKMRNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHRPIET
Sequence of entity 6 (e), FASTA
>9W2T_6 ATP synthase F(0) complex subunit e, mitochondrial (chains e)
PPVQVSPLIKLGRYSALFLGMAYGAKRYNYLKPRAEEERRLAAEEKKKRDEQKRIERELA
EAQEDTILK
Sequence of entity 7 (f), FASTA
>9W2T_7 ATP synthase F(0) complex subunit f, mitochondrial (chains f)
PLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLSMVLA
AYVFLNYCRSYKELKHERLRKYH
Sequence of entity 8 (g), FASTA
>9W2T_8 ATP synthase F(0) complex subunit g, mitochondrial (chains g)
TYSKPRLATFWYYAKVELVPPTPAEIPTAIQSLKKIINSAKTGSFKQLTVKEALLNGLVA
TEVWMWFYVGEIIGKRGII
Sequence of entity 9 (j), FASTA
>9W2T_9 ATP synthase F(0) complex subunit j, mitochondrial (chains j)
LQSLIKKVWIPMKPYYTQAYQEIWVGTGLMAYIVYKIRSADKRSKALK
Sequence of entity 10 (k), FASTA
>9W2T_10 ATP synthase F(0) complex subunit k, mitochondrial (chains k)
TGIKKYFNSYTLTGRMNCVLATYGSIALIVLYFKLR
Primary citation
Structures of respiratory supercomplexes and ATP synthase oligomers in mammalian mitochondrial inner membrane. Nakano, A., Masuya, T., Akisada, S. et al. Nat Commun (2026) 17. DOI 10.1038/s41467-026-70578-x · PubMed
Other PDB entries of the same protein (UniProt P03929 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 6ZQM 3.29 Å, bovine ATP synthase monomer state 2 (combined)
- 9W2R 3.4 Å, Cryo-EM structure of FoF1-ATPase monomer state 1 on the bovine heart submitochondrial…
- 6ZIT 3.49 Å, bovine ATP synthase Stator domain, state 2
- 6ZBB 3.61 Å, bovine ATP synthase Fo domain
- 6ZPO 4.0 Å, bovine ATP synthase monomer state 1 (combined)
- 6ZQN 4.0 Å, bovine ATP synthase monomer state 3 (combined)
- 9W2S 4.0 Å, Cryo-EM structure of FoF1-ATPase monomer state 3 on the bovine heart submitochondrial…
- 6ZIQ 4.33 Å, bovine ATP synthase stator domain, state 1
- 9VPB 5.0 Å, Cryo-EM structure of the IF1 bound bovine F-ATP synthase planar dimer
- 6ZIU 6.02 Å, bovine ATP synthase stator domain, state 3
- 9VPC 7.2 Å, Cryo-EM structure of the IF1 bound bovine ATP synthase tetramer
- 7AJF 8.45 Å, bovine ATP synthase dimer state2:state2
Browse structure collections
About this viewer
MolViewer shows 9W2T directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.