9W6E: Histone H3.1
Cryo-EM structure of a stacked human nucleosome core particle dimer assembled with DNA truncated at SHL-4.5. Determined by electron microscopy at 3.7 Å resolution. Released 12 Aug 2026.
- Method
- Electron microscopy
- Resolution
- 3.7 Å
- Organisms
- Homo sapiens, Escherichia coli
- Chains
- 20
- Atoms
- 20,759
- Mol. weight
- 364.48 kDa
- Released
- 12 Aug 2026
Explore 9W6E in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
9W6E contains 68 α-helices and 32 β-strands across 16 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 5 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-54 | 10 | |
| α-helix | 64-76 | 13 | |
| α-helix | 86-114 | 29 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 121-131 | 11 | |
Chain B: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-40 | 10 | |
| β-strand | 45-46 | 2 | 1 |
| α-helix | 50-75 | 26 | |
| α-helix | 83-93 | 11 | |
| β-strand | 96-97 | 2 | 2 |
Chain C: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 27-35 | 9 | |
| β-strand | 42-43 | 2 | 3 |
| α-helix | 46-72 | 27 | |
| β-strand | 77-78 | 2 | 4 |
| α-helix | 80-88 | 9 | |
| α-helix | 92-96 | 5 | |
| β-strand | 100-102 | 3 | 5 |
Chain D: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 4 |
| α-helix | 56-83 | 28 | |
| β-strand | 88-89 | 2 | 3 |
| α-helix | 91-101 | 11 | |
| α-helix | 106-123 | 18 | |
Chain E: 5 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 41-42 | 2 | |
| α-helix | 45-56 | 12 | |
| α-helix | 64-78 | 15 | |
| β-strand | 83-84 | 2 | 6 |
| α-helix | 86-113 | 28 | |
| β-strand | 118-119 | 2 | 7 |
| α-helix | 121-130 | 10 | |
Chain F: 4 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 26-28 | 3 | |
| α-helix | 31-41 | 11 | |
| β-strand | 45-46 | 2 | 7 |
| α-helix | 50-75 | 26 | |
| β-strand | 80-81 | 2 | 6 |
| α-helix | 84-93 | 10 | |
| β-strand | 96-98 | 3 | 5 |
Chain G: 5 helices, 3 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 17-21 | 5 | |
| α-helix | 28-35 | 8 | |
| β-strand | 42-43 | 2 | 8 |
| α-helix | 46-73 | 28 | |
| β-strand | 77-78 | 2 | 9 |
| α-helix | 80-89 | 10 | |
| α-helix | 92-96 | 5 | |
| β-strand | 100-101 | 2 | 2 |
Chain H: 4 helices, 2 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 38-48 | 11 | |
| β-strand | 53-54 | 2 | 9 |
| α-helix | 58-83 | 26 | |
| β-strand | 88-89 | 2 | 8 |
| α-helix | 91-101 | 11 | |
| α-helix | 105-121 | 17 | |
8 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Histone H3.1 | A, E, K, O | protein | 135 | Homo sapiens | P68431 (AlphaFold model) |
| Histone H4 | B, F, L, P | protein | 102 | Homo sapiens | P62805 (AlphaFold model) |
| Histone H2A type 1-D | C, G, M, Q | protein | 129 | Homo sapiens | P20671 (AlphaFold model) |
| Histone H2B type 2-E | D, H, N, R | protein | 125 | Homo sapiens | Q16778 (AlphaFold model) |
| DNA (119-mer) | I, S | DNA | 119 | Escherichia coli | |
| DNA (119-mer) | J, T | DNA | 119 | Escherichia coli | |
Sequence of entity 1 (A, E, K, O), FASTA
>9W6E_1 Histone H3.1 (chains A, E, K, O)
ARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTEL
LIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIM
PKDIQLARRIRGERA
Sequence of entity 2 (B, F, L, P), FASTA
>9W6E_2 Histone H4 (chains B, F, L, P)
SGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKV
FLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYGFGG
Sequence of entity 3 (C, G, M, Q), FASTA
>9W6E_3 Histone H2A type 1-D (chains C, G, M, Q)
SGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKKT
ESHHKAKGK
Sequence of entity 4 (D, H, N, R), FASTA
>9W6E_4 Histone H2B type 2-E (chains D, H, N, R)
PEPAKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSIYVYKVLKQVHPDTGISSKAMG
IMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTK
YTSSK
Sequence of entity 5 (I, S), FASTA
>9W6E_5 DNA (119-MER) (chains I, S)
ATCGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTACGTGCGTT
TAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCGAT
Sequence of entity 6 (J, T), FASTA
>9W6E_6 DNA (119-MER) (chains J, T)
ATCGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAA
ACGCACGTACGCGCTGTCCCCCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCGAT
Primary citation
Structural basis for nucleosome stacking diversity mediated by solvent-exposed histone interfaces. Mu, Z., Huang, J. To be published.
Other PDB entries of the same protein (UniProt P68431 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 5SVY 1.05 Å, MORC3 CW in complex with histone H3K4me1
- 2V89 1.1 Å, Crystal structure of RAG2-PHD finger in complex with H3K4me3 peptide at 1.1A resolution
- 5SZC 1.19 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 5SZB 1.2 Å, Structure of human Dpf3 double-PHD domain bound to histone H3 tail peptide with…
- 6BHD 1.25 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 4UP0 1.28 Å, Ternary crystal structure of the Pygo2 PHD finger in complex with the B9L HD1 domain and…
- 5WXH 1.3 Å, Crystal structure of TAF3 PHD finger bound to H3K4me3
- 5FFV 1.3 Å, Crystal structure of the bromodomain of human BRPF1 in complex with H3K14ac histone…
- 4L7X 1.35 Å, Crystal structure of the DIDO PHD finger in complex with H3K4me3
- 6BHE 1.35 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 6BHI 1.4 Å, Crystal structure of SETDB1 with a modified H3 peptide
- 3ASL 1.41 Å, Structure of UHRF1 in complex with histone tail
Browse structure collections
About this viewer
MolViewer shows 9W6E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.