9WSX: Endomorphin-1-muOR-arrestin2-Fab30 complex

Cryo-EM structure of endomorphin-1-muOR-arrestin2-Fab30 complex. Determined by electron microscopy at 2.8 Å resolution. Released 26 Nov 2025.

Method: Electron microscopy
Resolution: 2.8 Å
Organisms: Mus musculus, Homo sapiens, Bos taurus
Chains: 5
Atoms: 7,623
Mol. weight: 136.96 kDa
Released: 26 Nov 2025

Explore 9WSX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9WSX contains 33 α-helices and 66 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 9 helices, 26 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	2
β-strand	19-22	4	2
β-strand	26-28	3	3
β-strand	29	1	4
β-strand	34	1	4
α-helix	35-36	2
β-strand	37-42	6	2
β-strand	52-62	11	5
β-strand	76-87	12	5
α-helix	99-107	9
β-strand	112-117	6	2
α-helix	119-120	2
β-strand	127-130	4	5
β-strand	140-151	12	5
α-helix	160-162	3
β-strand	163-168	6	5
β-strand	169-171	3	3
α-helix	180-182	3
β-strand	183-188	6	6
α-helix	196	1
β-strand	197-203	7	6
β-strand	207-209	3	7
β-strand	214-222	9	6
α-helix	226-227	2
β-strand	228-242	15	8
β-strand	249-258	10	8
β-strand	262	1	8
β-strand	266-274	9	6
β-strand	287-289	3	5
β-strand	300	1	5
α-helix	301-305	5
β-strand	316-330	15	8
β-strand	340-349	10	8
β-strand	350-352	3	7
α-helix	354-357	4

Chain H: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	9
β-strand	14	1	10
β-strand	20-28	9	9
β-strand	35-42	8	11
β-strand	48-55	8	11
β-strand	60-63	4	11
β-strand	71-76	6	9
β-strand	81-87	7	9
α-helix	91-93	3
β-strand	95-103	9	11
β-strand	110-113	4	11
β-strand	117-119	3	11
β-strand	120	1	10
α-helix	128-129	2
β-strand	130-133	4	12
β-strand	149-153	5	12
β-strand	161-164	4	13
α-helix	165-167	3
β-strand	173-175	3	12
α-helix	176-178	3
β-strand	179-180	2	12
β-strand	186-192	7	12
β-strand	206-210	5	13
β-strand	215-219	5	13

Chain L: 6 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	14
β-strand	11-14	4	15
β-strand	20-26	7	14
β-strand	34-39	6	15
β-strand	46-50	5	15
β-strand	54-55	2	15
α-helix	56	1
β-strand	63-68	6	14
β-strand	71-76	6	14
α-helix	81-83	3
β-strand	86-91	6	15
α-helix	97	1
β-strand	98	1	15
β-strand	103-107	5	15
β-strand	112	1	16
β-strand	117-119	3	17
α-helix	120-122	3
α-helix	123-126	4
β-strand	133-140	8	17
β-strand	141	1	16
β-strand	161-164	4	17
α-helix	165-168	4
β-strand	174-180	7	17

Chain R: 14 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	66-92	27
α-helix	93-97	5
α-helix	102-118	17
α-helix	121-130	10
α-helix	137-170	34
α-helix	172-178	7
α-helix	181-194	14
α-helix	196-203	8
β-strand	211	1	1
β-strand	214	1	1
α-helix	225-237	13
α-helix	238-242	5
α-helix	243-260	18
α-helix	271-305	35
α-helix	312-336	25
α-helix	341-350	10
β-strand	368-371	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mu-type opioid receptor,Vasopressin V2 receptor	R	protein	386	Mus musculus, Homo sapiens	P30518 (AlphaFold model), P42866 (AlphaFold model)
Beta-arrestin-1	C	protein	393	Bos taurus	P17870 (AlphaFold model)
Fab30 heavy chain	H	protein	236	synthetic construct
Fab30 light chain	L	protein	216	synthetic construct
endomorphin-1	P	protein	5	synthetic construct

Sequence of entity 1 (R), FASTA

>9WSX_1 Mu-type opioid receptor,Vasopressin V2 receptor (chains R)
GPMGPGNISDCSDPLAPASCSPAPGSWLNLSHVDGNQSDPCGPNRTGLGGSHSLCPQTGS
PSMVTAITIMALYSIVCVVGLFGNFLVMYVIVRYTKMKTATNIYIFNLALADALATSTLP
FQSVNYLMGTWPFGNILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALDFRTPR
NAKIVNVCNWILSSAIGLPVMFMATTKYRQGSIDCTLTFSHPTWYWENLLKICVFIFAFI
MPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIHIYVII
KALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCICARGRTPPSL
GPQDESCTTASSSLAKDTSSLEVLFQ

Sequence of entity 2 (C), FASTA

>9WSX_2 Beta-arrestin-1 (chains C)
MGDKGTRVFKKASPNGKLTVYLGKRDFVDHIDLVEPVDGVVLVDPEYLKERRVYVTLTCA
FRYGREDLDVLGLTFRKDLFVANVQSFPPAPEDKKPLTRLQERLIKKLGEHAYPFTFEIP
PNLPCSVTLQPGPEDTGKACGVDYEVKAFCAENLEEKIHKRNSVRLVIEKVQYAPERPGP
QPTAETTRQFLMSDKPLHLEASLDKEIYYHGEPISVNVHVTNNTNKTVKKIKISVRQYAD
ICLFNTAQYKCPVAMEEADDTVAPSSTFCKVYTLTPFLANNREKRGLALDGKLKHEDTNL
ASSTLLREGANREILGIIVSYKVKVKLVVSRGGLLGDLASSDVAVELPFTLMHPKPKEEP
PHREVPEHETPVDTNLIELDTNDDDAAAEDFAR

Sequence of entity 3 (H), FASTA

>9WSX_3 Fab30 heavy chain (chains H)
MEISEVQLVESGGGLVQPGGSLRLSCAASGFNVYSSSIHWVRQAPGKGLEWVASISSYYG
YTYYADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCARSRQFWYSGLDYWGQGTLV
TVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAV
LQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTENLYFQ

Sequence of entity 4 (L), FASTA

>9WSX_4 Fab30 light chain (chains L)
MSDIQMTQSPSSLSASVGDRVTITCRASQSVSSAVAWYQQKPGKAPKLLIYSASSLYSGV
PSRFSGSRSGTDFTLTISSLQPEDFATYYCQQYKYVPVTFGQGTKVEIKRTVAAPSVFIF
PPSDSQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSST
LTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (P), FASTA

>9WSX_5 endomorphin-1 (chains P)
YPWFX

Primary citation

The molecular basis of mu-opioid receptor signaling plasticity. Zhang, H., Wang, X., Xi, K. et al. Cell Res (2025) 35:1021-1036. DOI 10.1038/s41422-025-01191-8 · PubMed

Other PDB entries of the same protein (UniProt P30518 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7DFC 2.49 Å, Crystal of Arrestin2-V2Rpp-3-Fab30 complex
9HAP 2.5 Å, Cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
9HB3 2.5 Å, cryo-EM structure of inactive human arginine-vasopressin (AVP) V2 receptor (V2R) with…
7DFA 2.54 Å, Crystal of Arrestin2-V2Rpp-4-Fab30 complex
4JQI 2.6 Å, Structure of active beta-arrestin1 bound to a G protein-coupled receptor phosphopeptide
7DW9 2.6 Å, Cryo-EM structure of human V2 vasopressin receptor in complex with an Gs protein
9ZZO 2.6 Å, MP1104-bound Kappa Opioid Receptor in complex with beta-arrestin1
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
7KH0 2.8 Å, Cryo-EM structure of the human arginine vasopressin AVP-vasopressin receptor V2R-Gs…
9WSV 2.8 Å, Cryo-EM structure of DAMGO-muOR-arrestin-1-Fab30 complex
9WSW 2.8 Å, Cryo-EM structure of endomorphin-1-muOR-Gz-scFv16 complex
9UVW 2.89 Å, Cryo-EM structure of Vasopressin receptor 2 (V2R)-BRIL/anti BRIL SRP2070 Fab antibody…

Browse structure collections

About this viewer

MolViewer shows 9WSX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.